KEGG   Celeribacter manganoxidans: CBW24_00215Help
Entry
CBW24_00215       CDS       T05128                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cmag  Celeribacter manganoxidans
Pathway
cmag00240  Pyrimidine metabolism
cmag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CBW24_00215
Enzymes [BR:cmag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CBW24_00215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: ATI43222
UniProt: A0A291M2R3
LinkDB All DBs
Position
complement(43022..43627)
Genome map
AA seq 201 aa AA seqDB search
MAKLYFHYSTMNAGKSTILLQASHNYIERGMQTYLLTAALDTRAGEGRIGSRIGIGAPSD
VFREGDDLFARIEARLAEGPCACVFVDEAQFLTEAQVWQLARVVDDLNVPVMCYGLRVDF
LGQLFPGSAALLTLADEMREVRTICHCGRKATMVIRRDADGQVSTSGDQVQIGGNETYVS
LCRRHWREAVGDRLPDLSPTG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttccattattcgaccatgaacgccggcaagagcacgatcctgctg
caagcgtcgcataactatatcgaacgggggatgcagacctatctgctgaccgccgcattg
gatacccgcgcgggcgaaggccggattggcagccggatcgggatcggcgccccgtctgac
gtgtttcgcgaaggcgacgacctgttcgcccggatcgaggcgcgactggccgaaggcccc
tgcgcctgcgttttcgtggatgaggcgcaattcctgaccgaagcgcaggtctggcaactg
gcgcgcgtggtcgatgacctgaacgtgccggtcatgtgctatgggctgcgggtggatttt
ctggggcagttgttccccggctccgcggcgctgctgacattggcggatgagatgcgcgaa
gtgcggacgatctgccattgcggacgcaaggcgacgatggtgatccgccgcgatgccgat
ggtcaggtctcgacctcgggcgatcaggtgcagatcggcggcaatgaaacctatgtgtcc
ctgtgccgccgccattggcgcgaagcggtgggcgaccggctgcccgatctgtcgcccacc
ggctga

DBGET integrated database retrieval system