KEGG   Celeribacter manganoxidans: CBW24_07745Help
Entry
CBW24_07745       CDS       T05128                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
cmag  Celeribacter manganoxidans
Pathway
cmag00040  Pentose and glucuronate interconversions
cmag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBW24_07745
Enzymes [BR:cmag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     CBW24_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_11 Pyr_redox_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ATI41902
UniProt: A0A291LYX7
LinkDB All DBs
Position
1720908..1721960
Genome map
AA seq 350 aa AA seqDB search
MKALVLERQGELSLRDIDLPSDMGPTDVRIKLHTVGVCGSDVHYYTHGKIGDFVVNAPMV
LGHEASGTVIEVGKDVTTLNVGDRVCMEPGVPDLTSRASKLGIYNVDPAVTFWATPPVHG
VLCAECVHPAAFTFKLPDTVSFAEAAMVEPFAVGMQAAKRAHIAPGDTAVVLGAGTIGIM
TALAALAAGCARVLISDLSAEKLAIAESYDGITGINIRQTSVVDAVAEVTAGWGADVVFE
CSGAQAAMNDLFRIVRPGGAIVFVGLPPDPVAIDISAATVRECRMETVFRYANVFDRALD
LIAAGKVDLKPLLSETYPFDASIEAFDRAAEGRPSDVKLQIRVDTESEAP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcttgttctcgaacgccaaggagagctctccttgcgggatatcgacctgccc
agcgacatgggcccgacagatgtccgcatcaagctgcacacggtcggggtctgcggatcg
gacgtgcattactacacccatggcaagatcggcgatttcgtcgtgaacgcgcccatggtg
ctggggcacgaagcgtcgggcaccgtgatcgaggtcggcaaggacgtcacgaccctgaac
gtgggcgaccgcgtctgcatggagccgggcgtgccggacctgacctcgcgcgcctcgaag
cttggtatctataacgtcgaccctgcggtcaccttctgggccacaccgccggttcatggc
gtgctctgtgccgaatgcgtgcatcctgccgcattcaccttcaagttgcccgacacggtg
tcttttgccgaggccgcgatggtggagccctttgccgtggggatgcaggccgcgaaacgg
gcgcatatcgcgccgggcgacacggcggtggttctgggcgcaggcaccatcggcatcatg
accgccctcgctgcgctggcagcaggctgtgcgcgtgtgctgatctccgacctttcggcg
gaaaagctggccatcgccgaaagctatgacggcatcaccggcatcaatatccgccagaca
tccgtcgtggacgccgtggccgaggtcaccgcaggctggggcgccgatgtggtctttgaa
tgctccggcgctcaggccgcgatgaacgatctgttccgcatcgtgcgtccgggcggggcg
attgtctttgtcgggctgccgcctgatcccgtcgccatcgacatctcggcggcgaccgtg
cgtgaatgtcggatggaaacggtgttccgctatgcaaacgtgttcgaccgcgcgctggac
ctcattgctgcgggcaaggtcgatctgaagccgcttttgtcggaaacctatccctttgac
gcgtcaattgaggcttttgaccgcgccgccgaggggcgcccctccgatgtgaaactgcag
atccgcgtcgataccgaaagcgaggccccgtaa

DBGET integrated database retrieval system