KEGG   Celeribacter manganoxidans: CBW24_13655Help
Entry
CBW24_13655       CDS       T05128                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cmag  Celeribacter manganoxidans
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cmag03012]
    CBW24_13655
   03029 Mitochondrial biogenesis [BR:cmag03029]
    CBW24_13655
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmag04147]
    CBW24_13655
Translation factors [BR:cmag03012]
 Eukaryotic Type
  Elongation factors
   CBW24_13655
 Prokaryotic Type
   CBW24_13655
Mitochondrial biogenesis [BR:cmag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CBW24_13655
Exosome [BR:cmag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBW24_13655
  Exosomal proteins of breast cancer cells
   CBW24_13655
  Exosomal proteins of colorectal cancer cells
   CBW24_13655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ATI42945
UniProt: A0A291M2J7
LinkDB All DBs
Position
complement(2979660..2980835)
Genome map
AA seq 391 aa AA seqDB search
MAKEKFARTKPHVNIGTVGHVDHGKTTLTAAITKYFGDFRAYDQIDGAPEEKARGITIST
AHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGGILVVNAADGPMPQTREHILLARQ
VGVPALVVFMNKVDQVDDEELLELVEMEIRELLSSYEFPGDDIPIVAGSALAAMEGRDPE
IGENKIRELMAAVDDYIPTPERAVDQPFLMPIEDVFSISGRGTVVTGRVERGVVNVGDEL
EIVGIRDTKKTTCTGVEMFRKLLDRGEAGDNIGALLRGIDREGVERGQVLCKPGSVKPHT
KFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVTLPEGTEMVMPGDNLKFAVEL
IAPIAMEDGLRFAIREGGRTVGAGVVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgcgcgtacgaaaccgcatgtgaacatcggcaccgtgggtcac
gttgaccacggcaagacgacgctgacggctgcgatcacgaagtatttcggtgacttccgc
gcctatgaccagatcgacggcgcgcccgaagagaaggcccgcggcatcacgatctcgact
gcgcatgtggaatacgagaccgaagcgcgtcactacgcccatgtcgactgccccggccac
gctgactatgtgaagaacatgatcaccggtgcggcgcagatggacggcggcattctggtt
gtgaacgcagccgacggcccgatgccccagacccgcgagcacatcctgctggcccgtcag
gttggcgtgcccgcgctggtcgtgttcatgaacaaggtcgaccaggtggatgacgaggag
cttctggagctcgtcgagatggaaatccgcgaactgctgtcgtcctacgagttccccggc
gacgatatcccgatcgttgcgggctccgctctggcggcgatggaaggccgtgacccggaa
atcggcgagaacaagatccgcgaactgatggcggctgtcgacgactacatcccgacgccc
gagcgcgccgtggaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggcaccgttgtgaccggccgtgtcgagcgtggcgtcgtcaacgtgggtgacgaactg
gaaatcgtgggcatccgcgacaccaagaaaaccacctgcaccggcgtcgaaatgttccgc
aagctgctggatcgcggggaagccggcgacaacatcggcgccctgctgcgcggcatcgac
cgtgaaggcgtcgagcgtggtcaggttctgtgtaagccgggttcggtgaagccgcacacg
aagttcgaggccgaagcctacatcctcaccaaagaggaaggtggccgtcacactccgttc
tttgcgaactaccgcccgcagttctacttccggaccacggacgtcaccggcaccgtcacg
ctgcccgagggcaccgagatggtcatgcccggcgacaacctgaagttcgccgttgaactg
atcgcgccgatcgccatggaagacggtctgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgccggcgtcgtctcgaaaatcatcgagtaa

DBGET integrated database retrieval system