KEGG   Celeribacter manganoxidans: CBW24_15360Help
Entry
CBW24_15360       CDS       T05128                                 

Definition
(GenBank) Curdlan synthase
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
cmag  Celeribacter manganoxidans
Pathway
cmag00500  Starch and sucrose metabolism
cmag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBW24_15360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmag01003]
    CBW24_15360
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmag02000]
    CBW24_15360
Enzymes [BR:cmag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     CBW24_15360
Glycosyltransferases [BR:cmag01003]
 Polysaccharide
  Structural polysaccharide
   CBW24_15360
Transporters [BR:cmag02000]
 Other Transporters
  Others
   CBW24_15360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Cellulose_synt
Motif
Other DBs
NCBI-ProteinID: ATI43531
UniProt: A0A291M3H5
LinkDB All DBs
Position
pDY25-A:complement(36274..38283)
Genome map
AA seq 669 aa AA seqDB search
MLLLHLTEFESSLVQLLLVFGAMMVLPYFVDPQKSWHRAGLFAIAGLLGLRYAWWRATET
LAPPGFTIDFLASGSLLIIEMVALLGSISAFVLMSRFISRSDEADANLRWWVRARPGTPD
PRVAILIATYNEDIEVLERTIVGARTLRYANKEVIVLDDGRRDWLRDYCAEQSVRYMIRP
DNKGSKAGNINHALQRLAEDPVSPEFIAVLDADFVPHRGFLSRSLALFHDPRVGLVQTPQ
HFFNPDPIQHNLGLSRSYPDEQRFFFDHMQASRDAWGLAICCGTSSVARWSALQELGGFP
TESVTEDFMLTMALQERGWTTVYLNEALTEGLAPEGLKEYVTQRARWCLGLMQIARSRLG
PFGRNGLRLRDRWSVIDSVLYWSSSFVFRLAALTFPLLYWFANITVVNAAVPDVISYFAV
YYFWTISTQNLLSKGLLVPVFHDVSQTVGALPITRAAFTGLLKPHGHPFSVTAKGGDRSK
IVIQWTMMRPFLILFALTVLGLVIGIFSDRFAFYDAGDGKAVVLFWTVYNLLVLAVTMLA
CVELPRREQHIADEPELALMHLAGGGGDRHIWITSLTRDTVKVRGQKLSIGDRGVVEIPN
VGPVEAYVIAVDRDIARLQLLPGDAEREALLVKFHAEDNVPGVGEVSPVNLIRDFLRRLS
MIAPAKKPR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcttcatctgacggaattcgaatcgagcctcgtgcagctgttgctggtgttc
ggcgccatgatggtgctgccctatttcgtcgacccacagaaaagctggcaccgcgccgga
ttgttcgcgatcgcggggctgctgggactgcggtatgcgtggtggcgcgcgaccgagacc
ctggcaccgccggggttcaccatcgatttcctcgcctccggctcgttgttgatcatcgag
atggtcgcgttgctcggctcgatcagcgcgttcgtcctgatgtcacgcttcatttcgcgc
agcgacgaggccgacgccaatctgcgctggtgggtgcgcgcacgccccggcacgcccgat
ccccgcgtcgcaatcctgatcgcgacctataacgaggacatcgaggttctggagcgcacc
atcgtcggggcccggaccctgcgctacgccaataaagaagtgatcgttctggacgatggc
cgccgggactggctgcgcgattactgcgcggagcaaagcgtccgctacatgatccgccct
gataacaaagggtcgaaagcaggcaatatcaaccacgcgctgcaacggctggccgaagac
ccggtaagccccgaattcatcgcggtgctggacgccgatttcgtgccgcatcgcgggttt
ctgtcgcggtcgctggcgctgttccatgacccgcgcgtcgggctggtgcaaacgccgcag
catttcttcaatcccgatcccatccagcataatctggggctcagccgctcctacccggat
gagcagcggttcttcttcgatcacatgcaggccagccgggatgcgtgggggctggcgata
tgctgtggcacgtcgtcggtggcgcggtggtcggcgttgcaggaactcggcgggtttccg
accgaaagcgtgaccgaagatttcatgctgacgatggcgttgcaggaacggggctggaca
accgtctacctgaacgaagcgctgaccgaagggctcgcccccgaagggctgaaggaatat
gtcacccagcgcgcgcgctggtgtctggggctgatgcaaatcgcccgttcccgtctgggg
ccgttcgggcgcaatggcctgcgcctgcgggaccgctggagcgtgatcgactccgtgctt
tactggtcgtcgtcctttgtgtttcgcctcgccgcgctgacctttccgctgctctactgg
tttgcgaatattacggtggtcaatgccgccgtgccggacgtcatcagctacttcgcggtc
tattacttctggacgatctccacccagaacctgctgtcaaaggggctgctggtgcccgtc
tttcacgacgtcagccagacggtcggtgccctgcccatcacccgcgcggcgtttaccggg
ctgctcaagccgcatgggcatccgttttcggttacggccaagggcggcgaccgcagcaaa
atcgtgatccaatggaccatgatgcgcccgtttctgatcctgttcgcgctgacggtgctg
ggtctggtgatcggcattttcagcgacagattcgcattctacgacgccggggatggcaag
gcggtggtgctgttctggacggtctacaacctgctggttctggcggtgacgatgttggcc
tgtgtcgagctgccgcgccgcgagcagcatatcgcggatgagcctgaactggcgctgatg
catctggccggaggcggcggcgaccggcatatctggatcacctcgctgacccgcgacacg
gtcaaggtccgtggccagaaactatccatcggtgatcgcggggtggtcgaaatccccaat
gtcggcccggtcgaggcctatgtgatcgcggtggatcgcgacatcgcgcggcttcagttg
ctgcccggcgatgcggagcgcgaggcgctgctggtcaagttccatgccgaagacaacgtg
cccggcgtgggcgaggtcagcccggtgaacctgatccgcgatttcctccgccgcctgtcg
atgatcgccccggccaagaaaccgaggtga

DBGET integrated database retrieval system