KEGG   Celeribacter manganoxidans: CBW24_16340Help
Entry
CBW24_16340       CDS       T05128                                 

Definition
(GenBank) Rieske (2Fe-2S) protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
cmag  Celeribacter manganoxidans
Pathway
cmag00627  Aminobenzoate degradation
cmag01100  Metabolic pathways
cmag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CBW24_16340
Enzymes [BR:cmag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     CBW24_16340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A Rieske_2
Motif
Other DBs
NCBI-ProteinID: ATI43818
UniProt: A0A291M4T0
LinkDB All DBs
Position
pDY25-B:59960..61195
Genome map
AA seq 411 aa AA seqDB search
MPVWAKEDEGFHVPYWVFQREDVLEMENERLFQGETWNYMCLEAELQSPGDFVAVHVGET
PVIVTRDHDGEIYAFENRCSHRGSLLALEDRGNVKDFTCVYHAWTHSLQGDLVGIAFKDG
IGGKGGMEKDFCMNSVGPRKLRVANVEGLIFGSFDEDVDDIEDYLGDEVLGRIRRVLEGR
KMVALGRFTQVLPNNWKLYVENTKDSYHASILHTFFTTFELNRLSQKGGIIVSPNGGCHV
SYSEIDQVAEAEKAKNTIYSDQKIRSQSDLQLADKSLLASFKEFDDDITLQILTVFPGFV
LQQIQNSIAVRQVLPKGTDEMHLKWTYIGFEDDTTEQRRARLKLSNLIGPGGYVSMEDGC
IGGFVRRGTKGASDNNAVLEMGGRSIEGGDDRITEASIRGFWAEYRMRMGL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtttgggcgaaggaagatgagggtttccatgtcccttactgggtgttccagcgc
gaagacgttctggagatggaaaatgagcgcctgttccagggggaaacctggaactacatg
tgtcttgaagccgaacttcagtcgcccggcgatttcgtcgcggtccatgtgggggaaacc
ccggtcatcgtgacccgcgaccatgacggcgagatttatgcgttcgagaaccgctgctcg
catcgcggctcgcttctggcgctggaagatcgcggcaacgtcaaggatttcacctgcgtc
tatcatgcctggacccacagcctgcaaggtgacctagtcgggatcgccttcaaggacggg
atcggcggcaaaggcgggatggagaaggatttctgcatgaactccgttggccctcgcaag
ctgcgcgtggccaatgtcgaagggctgatcttcggcagcttcgacgaggacgtggacgat
atcgaggattacctgggcgatgaggttcttggccgcatccgccgcgtgctggaaggccgc
aagatggtggctctgggccggttcacgcaggtgcttcccaacaactggaagctctatgtt
gagaacaccaaggacagctatcacgccagcatcctgcacaccttcttcacgaccttcgag
ctgaaccggctgtcgcagaagggcggaatcattgtcagcccgaatggcggctgccatgtg
agctattccgagatcgaccaggtcgcggaagccgagaaggcgaagaacacgatctattcg
gaccagaagatccggtcgcaatcggacctgcaactggccgacaagtcgctgctggcgagc
ttcaaggaattcgacgacgacatcaccctgcagatcctcacggtctttccgggcttcgtc
cttcaacagatccagaactcgatcgcagtgcgtcaggtcctgccgaaaggcaccgacgag
atgcatctcaaatggacctatatcgggttcgaggatgacacgaccgaacagcgccgcgcg
cgtctgaaactgtcgaacctgatcgggccgggcgggtatgtgtcgatggaagacggctgt
atcggcggcttcgtgcgccgcggcaccaagggcgcgtcggacaacaatgccgtgctcgaa
atgggcgggcgcagcatcgaaggcggcgacgaccgcattacggaagcctcgatccggggg
ttctgggcagaatacagaatgaggatggggctatga

DBGET integrated database retrieval system