KEGG   Cobetia marina: BFX80_10790Help
Entry
BFX80_10790       CDS       T04789                                 

Definition
(GenBank) inosose dehydratase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
cmai  Cobetia marina
Pathway
cmai00562  Inositol phosphate metabolism
cmai01100  Metabolic pathways
cmai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BFX80_10790
Enzymes [BR:cmai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     BFX80_10790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N Ribonucleas_3_2
Motif
Other DBs
NCBI-ProteinID: AOM01690
LinkDB All DBs
Position
complement(2634531..2635439)
Genome map
AA seq 302 aa AA seqDB search
MHIKLSNAPCSWGIEFADNPANPSWQTVLDEIAGAGFKATELGPLNYLPTEQATLASALD
SRGLELIAGTIFKHLHDASRRQEILDYTRATCEVLKPQQGNYMVIIDHVSSPRTDEAGQQ
ETATRLDDAQWSEMMVTIRQVAEICQEYAVTPVLHPHAGTYIEYRDEVDRAMAELDADLV
KLCIDTGHCTYAGIDPAELIRTYGERVAYIHFKDIQAPVLESVVKDGIDFYTAIGQGVFC
PLGQGCVDFDAVRESLDSIGYQGWITVEQDVDPTKDNSALENARESREFIERSILEKGLA
EA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcaagctttccaatgcaccgtgttcctggggtatcgagtttgccgacaacccc
gccaatcccagttggcagaccgtgcttgacgaaatcgccggcgccggtttcaaggcgacg
gagcttggcccgctcaattacctgccgaccgagcaggccacactggcgtccgcgttggat
agtcgagggctcgagctgatcgccggtaccatcttcaagcatctgcacgatgcgtcacgc
cgtcaggaaatcctggattacacccgcgcgacctgtgaagtgctcaagcctcagcagggc
aactacatggtcatcatcgaccatgtcagctcgccacgtaccgatgaagccggccagcag
gaaaccgcgacccgtctcgatgatgcgcagtggagcgagatgatggtcactatccgtcag
gtggcggaaatctgtcaggaatatgcggtcacaccggtgctgcatccgcatgccggcacc
tacattgagtatcgcgatgaagtggaccgtgcgatggctgagctggatgctgatctggtc
aagctgtgcatcgataccgggcactgcacctacgccgggatcgatccggcagaactgatc
cgaacctacggtgagcgtgtggcctatatccacttcaaggatattcaggcgccagtactc
gaaagcgtggttaaggatggcatcgacttctataccgccatcggccagggcgtgttctgc
ccgctgggacagggctgtgtggactttgacgcggtccgcgagagcctggattccatcggc
tatcaaggctggatcaccgtcgagcaggacgtggacccgaccaaggacaacagcgcgctg
gaaaacgcccgcgaaagccgcgaattcatcgaacgcagcatactggagaaagggctggcc
gaagcctga

DBGET integrated database retrieval system