KEGG   Cobetia marina: BFX80_12470Help
Entry
BFX80_12470       CDS       T04789                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmai  Cobetia marina
Pathway
cmai00620  Pyruvate metabolism
cmai00680  Methane metabolism
cmai01100  Metabolic pathways
cmai01120  Microbial metabolism in diverse environments
cmai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFX80_12470
  09102 Energy metabolism
   00680 Methane metabolism
    BFX80_12470
Enzymes [BR:cmai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BFX80_12470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOM01951
LinkDB All DBs
Position
complement(3042486..3045134)
Genome map
AA seq 882 aa AA seqDB search
MSHDLHESLRDNVRILGDNLGQTIAADLGDDFVERIERIRALAKKGQQGDLAARRELIDY
LRDLPDSDLLPVTRAFNQFLNLSNIAEQHYRGRFKRVEDYRPGSQPDLGELITRIRERGF
SAQKIVEELSAMRVELVLTAHPTEVIRRTLIQKYDAIEGCLTQMEGACDRPEQATLARAR
LSELISQAWHTDEIRHERPTPVDEAKWGFATIENSLWQAVPDFHRQLDEMTLEAAGERLP
LDAAPLRFASWMGGDRDGNPNVTARVTRTVLLLGRWMAADLYLRDLEQLKSELSMWKCSA
ALRAEAGDVAEPYREILRRLILRMESTRDWAKAGLDGKRHEGLDIIETREQLYAPLLACY
RSLCDVGLDTIANGALLDTLRRVACFGVTLTKLDIRQESTRHAQVLDELTQSLGMGSYFE
WDEQKRCEFLARELGGQRPLIPRHWECSTDTREVLDTFKVIAREHREALGTYIISMAGQA
SDVLAVALLMKEVGGDVRLPIAPLFETLDDLDRSGPVIDTLLGMPIYRKHAGNRQEVMIG
YSDSAKDAGQLAAAWAQYRAQETLVDVTKRHGVELTLFHGRGGTVGRGGGPAHAAILSQP
PGSVTGSLRVTEQGEMIRFKFGLPDIASRSMEIYVCAVLEASLLPPPAPRQEWRDEMNRL
ADVAHKAYVGVVREDPNFVPYFRSVTPETALARLPLGSRPAKRRQDGGVETLRAIPWIFA
WTQIRLMLPAWLGSGEAFANRLEEEGGLEILREMMNDWPFFSTYVDMLEMLLSKADLSTA
AYYEQRLVDEPALKELGQSLRDRLERLEKVVLEIRDQQTLLEHMPLIRQAIDVRNPYIDP
LHGLQAELLQRNRDADGAISAELSRALMVTMAGISAGLRNTG
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgacctgcatgaatcgttgcgcgacaatgtgcgcattctcggggacaacctc
ggccagaccatcgcggccgacctcggcgatgacttcgtcgagcgtatcgaacgcatccgc
gccctggccaagaaaggccagcaaggcgacctcgcggcccgccgcgagttgatcgattac
ctgcgcgaccttcccgacagcgatctgctgccggtcacccgcgccttcaatcagtttctg
aatctttccaacatcgccgagcagcactaccgcggccgcttcaagcgtgtcgaggattat
cgtcccggcagtcagccggatctgggcgagctgatcacgcgtatccgtgagcgtggcttc
agtgcccagaagatcgtcgaggagctgtcggcgatgcgcgtcgagctggtgctgacggcc
cacccgacggaagtcatccgccgtaccctgatccagaagtacgatgccatcgaaggctgc
ctgacccagatggaaggtgcctgtgatcgcccggaacaggcgacgctcgcgcgtgcacgc
ctctctgagctgatcagccaggcctggcataccgacgagatccgtcacgagcgcccgacc
ccggtggacgaggccaagtggggctttgccaccatcgagaattcgctgtggcaggcggtg
cctgacttccatcgtcagctggacgagatgacactggaggcggccggcgagcgtctgccg
ctggacgccgcgccgctgcgcttcgcctcctggatggggggcgaccgcgatggcaacccg
aatgtcaccgcgcgggtcacccgcaccgtgctgctgctgggtcgctggatggcggcggat
ctctacctgcgggatctcgagcagctcaagtccgagctctccatgtggaagtgctccgcg
gcgctgcgtgccgaggccggcgacgtggcggaaccttaccgcgagatcctgcggcgtctg
atcctgcgcatggaaagcacccgtgactgggccaaggctggcctggacggcaagcgtcac
gaggggctcgacatcatcgagacgcgtgagcagctctatgcaccgctgctggcctgctac
cgctcgctgtgtgacgtgggactggataccatcgccaatggcgccttgctcgacacgctg
cgccgcgtggcctgtttcggcgtgactctcaccaagctcgacatccgtcaggaaagtacg
cgccacgcccaggtgctcgacgagctgacccagtcgctgggcatgggcagctacttcgag
tgggatgagcagaagcgctgtgaattcctcgccagggagctgggcggtcagcgtcccttg
atcccgcgtcattgggagtgctccaccgatacccgcgaagtgctggataccttcaaggtc
atcgcgcgtgaacatcgtgaggcgctgggcacctacatcatctcgatggcgggccaggcc
tccgatgtactggcggtggcgctgctgatgaaggaggtgggcggtgatgtgcgcctgccc
atcgcgccgctgttcgagaccctggacgacctggatcgctccggcccggtcatcgacacg
ctgctgggcatgccgatctatcgcaagcacgccggcaatcgtcaggaagtgatgatcggc
tattccgactccgccaaggatgccggccagctggcggcggcctgggcacagtatcgtgct
caggagacgctggtggatgtcaccaagcggcacggcgtcgaactgacgctcttccatggt
cgtggcggcacggtgggtcgcgggggcggtccggcacatgcggcgatcctctcgcagccg
ccgggctcggtgaccggttccctgcgcgtgaccgagcagggcgagatgatccgcttcaag
ttcggcctgccggacatcgccagccgctcgatggagatctatgtctgtgcagtcctcgag
gccagcctgctgccgccgcccgccccgcgtcaggaatggcgcgacgagatgaatcgtctc
gcggacgtcgcgcacaaggcctatgtcggagtggtgcgcgaggacccgaacttcgtgcct
tacttccgctcggtcacgccggagacggcactggcgcgcctgccgctggggtcacgcccg
gccaagcgtcgtcaggacggaggcgtcgagacgctgcgggcgatcccgtggatcttcgcc
tggacccagattcgtctgatgctgccggcgtggcttggcagtggcgaagccttcgccaat
cggctcgaggaagagggtgggctggaaatcctgcgcgagatgatgaacgactggccgttc
ttctccacctatgtcgacatgctggagatgctgctgtccaaggcggatctctcgacggcg
gcctactacgagcaacgtctggtggatgagccggcgctcaaggagctggggcagtcgctg
cgtgatcgtctcgagcgtctggagaaggtggtgctggagatccgcgatcaacagacgctg
ctggagcacatgccgctgatccgtcaggccatcgatgttcgcaacccctacatcgacccg
ttgcatggcctgcaggccgagcttctgcagcgcaaccgggatgccgatggcgccatctcc
gccgagctgtcgcgcgccctgatggtgaccatggccggtatctcggccggtctgcgcaac
accggctga

DBGET integrated database retrieval system