KEGG   Croceicoccus marinus: A9D14_07075Help
Entry
A9D14_07075       CDS       T04890                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cman  Croceicoccus marinus
Pathway
cman03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cman00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A9D14_07075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cman03400]
    A9D14_07075
Enzymes [BR:cman01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A9D14_07075
DNA repair and recombination proteins [BR:cman03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A9D14_07075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ARU15994
UniProt: A0A1Z1FB66
LinkDB All DBs
Position
complement(1466813..1469341)
Genome map
AA seq 842 aa AA seqDB search
MTTRTDPLAEYNAKRDFAKTPEPRGEAVKAKGEAKFVVQKHDATRLHWDLRLEMDGVYKS
WAVTKGPSPDTDIKRLAVRTEDHPISYGTFEGTIPKDEYGGGTVMLWDRGTWAPIEGKSA
RDIEKGHLHFILHGERMKGEWLLIRLKKKPGEKRENWLLRKLDDEFAEEGDALVERELTS
VLTGRSMAEIEADKKGEYLLEDKSGDAFAAQMKKASQRNAVKAKPARKRAAKSAAKLPEF
RKPQLAMLVDDVPAGNGWMHEIKFDGYRAMVAAKGDEVRVYTRSGKDWTDKFAPLVGVLA
ALDLPPCLIDGEIVATDGKGNPDFSTLQQVLKRGHGSQGADDALQFHAFDLLELNGEDLA
ALTNIERKERLEALLADAAPPIHVADHVIGAGEKLYDAMCKAGQEGVISKKIDAPYRHAR
SKGWLKIKCTRRQEFVVIGWKKSSAKGRPFASLLLAQNEGDELVYKGNVGTGFSGDDLDM
LTGRMKRLERKTPPAEVDKPSSRGVTWLTPRLVAEIAFAEFTADGNVRHGSFLGLRSDKD
ADEVTPEKPAKAPLVENEVEISSRDRVVFPDSGQTKGELADYYRAVAGIMLPFAARRPVS
LVRCPQGRAKKCFFQKHDSGGFGDAVRHVPIAEKDGGTEDYLYVEDARGILQCVQMGTIE
FHGWGSRTSDVEAPDRMIFDLDPDEGLDFDAVKTAAQDIRARLADIGLVSFAMLSGGKGV
HVVVPLTTGHDWAAHKDFARRFAEALSVAEPDRFVATMSKAKRKGRIFIDWLRNQRGSTA
VLPYSARARSGAPVAAPIGWNELKNIDNAHRWTIGDADELLKRASGKTLAGWGFADQALP
DI
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaggactgaccccctcgccgaatataacgcgaagcgcgacttcgcgaagacg
cccgaaccgcgcggagaggcggtcaaggcgaagggcgaggcgaaattcgtcgtgcagaag
cacgacgcgacccgcctgcactgggacctgcggctggaaatggacggcgtctataaaagc
tgggccgtcaccaagggaccgtcgcccgacaccgacatcaagcggctggccgttcggaca
gaggatcacccgatctcctacggcaccttcgaagggacgatccccaaggatgaatatggc
ggcggcacggtcatgctttgggatagggggacctgggccccgatcgaaggcaagagcgcc
agggacatcgagaaggggcatctgcatttcatcctgcatggcgagcggatgaagggggaa
tggctgttgataaggctgaagaaaaagccgggagaaaagcgggaaaactggctgctgcgc
aagctggacgatgaattcgccgaagagggcgacgcgctggtcgagcgcgaattgaccagc
gtgctgaccgggcgatcgatggcggagatcgaggccgacaagaagggcgaatatttgctg
gaggacaagagcggcgatgcattcgccgcgcagatgaaaaaggcttctcagcgcaatgcg
gtcaaggcgaaaccggctcgcaaacgtgccgccaagtcggccgccaaactgccggaattt
cggaaacctcaactggcgatgctggtcgacgacgtgccagcgggaaatggctggatgcat
gagataaaattcgacggctaccgcgccatggtggctgcgaaaggcgacgaggtgcgtgtc
tatacccgcagcggcaaggactggaccgacaagttcgctccgctggtcggggtgctcgcc
gctctcgacctgccgccttgcctgatcgacggagagattgtcgcgaccgatggcaagggc
aatcccgatttctctacattgcagcaggtgctgaagcgcgggcacggatcgcagggcgcg
gacgatgcgctgcagttccacgccttcgacctgctggaattgaacggcgaagacctagcg
gcgttgaccaatatcgaacgcaaggaacggctggaggcgctgctggccgatgccgcgccg
ccgattcacgttgccgaccatgtcatcggtgcgggcgagaagctgtacgacgcgatgtgc
aaggcggggcaggaaggggtcatctcgaaaaagatcgacgccccctatcgccatgcacgc
agcaagggttggctgaagatcaaatgcacccggcggcaggaattcgtcgtgatcggctgg
aagaagagcagcgccaagggacgcccgttcgcatccttgctgctggcccagaacgagggc
gacgagctggtctacaagggcaatgtcggcaccggcttttcgggcgacgatctcgacatg
ctgacgggcaggatgaagcggctggaacgcaagaccccgcccgccgaagtcgacaaaccg
tcgagcaggggcgtcacctggctcacccccagactggtcgccgagatcgcgttcgccgaa
ttcactgcggacggcaatgtgcgccacggcagctttcttggcttgcgatccgacaaggac
gcggacgaggttaccccggaaaaacccgccaaggctccgctggtggaaaacgaggtcgag
atttcaagccgcgaccgcgtggtgtttcccgattccggccagaccaagggcgagctggcc
gattactaccgggcggttgccggcatcatgctgccctttgccgccaggcgcccggtcagc
cttgtgcgctgtccgcaggggcgggcgaagaaatgctttttccagaagcacgacagcggc
ggctttggcgatgcggtccgccatgtccccatcgccgaaaaggacggcgggaccgaggat
tacctctatgtcgaggatgcgcgcggcatcctgcaatgcgtgcagatgggcacgatcgag
ttccacggatggggcagccgtacctccgatgtcgaggcgcccgaccggatgatcttcgac
ctcgaccccgacgaggggctggacttcgatgcggtgaagaccgccgcgcaggatattcgc
gcgcggcttgccgacatcggccttgtcagctttgccatgctgtcgggcggcaagggcgtg
catgtcgtggtgccgctgaccaccggccacgactgggccgcgcacaaggacttcgcccgc
cgtttcgccgaggcgctgagcgtggccgagcccgaccgcttcgtcgcgaccatgagcaag
gccaagcgcaaggggcggatcttcatcgactggctgcgcaaccagcgcggcagcacggcg
gtgctgccctattcggcgcgtgcgcgcagcggtgcgcccgtggccgcgcccatcggctgg
aacgagctgaagaacatcgacaatgcacatcgctggacaatcggcgatgctgacgaactg
ctgaaacgcgcatcgggcaagacgctggccgggtgggggttcgccgaccaggccctgccc
gatatctag

DBGET integrated database retrieval system