KEGG   Croceicoccus marinus: A9D14_11620
Entry
A9D14_11620       CDS       T04890                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
cman  Croceicoccus marinus
Pathway
cman00521  Streptomycin biosynthesis
cman00523  Polyketide sugar unit biosynthesis
cman00525  Acarbose and validamycin biosynthesis
cman01100  Metabolic pathways
cman01110  Biosynthesis of secondary metabolites
Module
cman_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    A9D14_11620
   01055 Biosynthesis of vancomycin group antibiotics
    A9D14_11620
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A9D14_11620
   00525 Acarbose and validamycin biosynthesis
    A9D14_11620
Enzymes [BR:cman01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     A9D14_11620
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind
Other DBs
NCBI-ProteinID: ARU16711
UniProt: A0A1Z1FD02
LinkDB
Position
2425896..2426957
AA seq 353 aa
MADLLVTGGAGFIGGNFVHYWRERHPGDTIVVLDALTYAGNRETIEDVDNVELVVGNICD
TALVTRLLEERGIDTIVHFAAESHVDRSISAPDDFIETNVIGTHSLLKAARDVWVEKGSG
RPHRFHHVSTDEVYGSLGPDDPAFSETTQYQPNSPYSASKAGSDHLVRAYHHTFGLEVTT
SNCSNNYGPYQYPEKLIPLFLLNALSGKPLPIYGDGMNVRDWLHVEDHCRGIEAVLKNGK
PGETYNIGGGQELPNLTVIEEICRGVDAIFASDPSLAERYPDAPAAKGRPTDTLKTFVTD
RKGHDRRYAIDETKAREEIGYTPSRDFPTGFAETLRWYLDNEGWWRAILARAG
NT seq 1062 nt   +upstreamnt  +downstreamnt
ttggctgatctgctcgtcaccggcggggccggattcatcggcggcaatttcgtgcattac
tggcgcgagcggcatcccggcgacacgatcgtcgtgctcgacgcgctgacctatgccggc
aaccgcgagaccatcgaggatgtcgacaatgtcgagctggtcgtcggcaatatctgcgac
accgcgctggtcacccgcctgctggaagagcgcgggatcgacaccatcgtgcatttcgcg
gccgagagccatgtcgaccgatcgatcagcgcaccggacgatttcatcgagaccaatgtc
atcggcacgcacagcctgctgaaggccgcgcgcgatgtctgggtcgaaaagggatcgggc
cgcccgcaccggtttcaccatgtctcgaccgacgaggtctacggctcgctcggccccgac
gatccagccttcagcgagacgacgcaatatcagccgaactcgccctattcggcgtccaag
gccgggtccgaccatcttgtgcgcgcctatcaccacaccttcgggcttgaggtgacgacc
agcaattgctcgaacaattacgggccctatcaatatcccgaaaagctgatcccgctgttc
ctgctgaacgcgctgtcgggcaagccgctgccgatctatggcgacggcatgaacgtgcgc
gactggctgcatgtcgaggatcactgccgcgggatcgaggcggtgctgaagaacggcaag
ccgggcgagacatataacatcggcggcgggcaggaactacccaatctgacggtgatcgag
gaaatctgccgcggcgtcgacgcgatcttcgcatccgatccctcgctggccgagcgctat
ccagacgcgcccgccgccaagggccggccgaccgatacgctgaagaccttcgtcaccgac
cgcaagggccacgaccgccgctacgccatcgacgagaccaaggcgcgcgaggagatcggc
tatacccccagccgcgacttcccgaccggctttgccgagaccttgcgctggtatctcgac
aacgaaggctggtggcgcgccattctcgccagggcgggatag

DBGET integrated database retrieval system