KEGG   Croceicoccus marinus: A9D14_12010Help
Entry
A9D14_12010       CDS       T04890                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
cman  Croceicoccus marinus
Pathway
cman00220  Arginine biosynthesis
cman00250  Alanine, aspartate and glutamate metabolism
cman00270  Cysteine and methionine metabolism
cman00330  Arginine and proline metabolism
cman00350  Tyrosine metabolism
cman00360  Phenylalanine metabolism
cman00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cman00401  Novobiocin biosynthesis
cman01100  Metabolic pathways
cman01110  Biosynthesis of secondary metabolites
cman01130  Biosynthesis of antibiotics
cman01210  2-Oxocarboxylic acid metabolism
cman01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9D14_12010
   00270 Cysteine and methionine metabolism
    A9D14_12010
   00220 Arginine biosynthesis
    A9D14_12010
   00330 Arginine and proline metabolism
    A9D14_12010
   00350 Tyrosine metabolism
    A9D14_12010
   00360 Phenylalanine metabolism
    A9D14_12010
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A9D14_12010
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    A9D14_12010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cman01007]
    A9D14_12010
Enzymes [BR:cman01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     A9D14_12010
Amino acid related enzymes [BR:cman01007]
 Aminotransferase (transaminase)
  Class I
   A9D14_12010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ARU16762
UniProt: A0A1Z1FDE3
LinkDB All DBs
Position
2520340..2521551
Genome map
AA seq 403 aa AA seqDB search
MSQPQLSQALQRIQPSPTTAMTDRATAMREAGRDIISLSVGEPDLPTPPHVIAAMQQALR
DGQTRYTPVGGTSAMKRAAALHFARDLNIAATPANTTISAGGKQAIFHALCATIDPGDEV
VIPAPWWVSYPEIARFAGATVVPLPTTPASAFRFTAQALEAAITPRTRWLLLNSPGNPTG
AVFPADELRAIAEVLDRHPRVLVMSDDIYAPLRYSGGDHATLAALRPDLAANGDKGRVLT
ISGVSKSHAMTGLRIGFATGPEWLIRAMERLQSHSSGNPCSISQAGAVAAMEGPQDFLAD
WRQIFRRRRDLVCAAVNAMPGLSTPVPDGAFYCLVDAAPLIGGDMPDDGALALHLLDHGV
AVVPASAFGGAHCGLSGFRISFAAGEDTLREALQRIETAVTKL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgcaactgtcacaggccctgcagcgcatccagccgtcgccgaccacggcg
atgacagaccgcgcgacggccatgcgcgaagcggggcgcgacatcatctcgctgtcggtg
ggcgaacccgatctgcccaccccgccccatgtcatcgcggcgatgcagcaggcgctgcgc
gatggccagacgcgctataccccggttggcgggaccagcgcgatgaagcgcgccgccgcg
ctgcatttcgcccgcgacctgaacatcgcggccacccccgccaacaccacgatcagcgcg
ggcggcaagcaggcgatcttccacgcgctttgcgccacgatcgatcccggcgacgaggtc
gtgatccccgccccctggtgggtcagctatcccgagattgcgcgcttcgccggtgcgacg
gtcgtgccgctgccgaccacgcccgccagcgccttccgcttcacggcgcaggcacttgag
gctgcgatcaccccgcgcacccgctggctgctgttgaacagcccgggcaatccgaccggc
gcggtgttcccggcggacgaactgcgcgccatcgccgaagtgctggaccgccacccccgc
gtgctggtgatgagcgacgatatctatgccccgctgcgctatagcggcggcgatcatgca
accctggccgcgctgcgccccgacctggcggccaatggcgacaagggccgcgtgctgacc
atatcgggcgtatcgaaaagccacgcgatgaccggcctgcgcatcggctttgccaccggc
cccgaatggctgatccgcgcgatggaacggctgcagtcgcacagcagcggcaatccctgt
tcgatcagccaggcgggcgcggtcgccgcgatggaggggccgcaggacttccttgccgat
tggcgccaaatttttcgccgccgccgcgacctggtgtgcgcagcggttaacgccatgccg
ggcctgtcgacaccggtgcccgacggggcgttctattgcctggtcgatgcagcgccgcta
atcggcggcgatatgcccgacgatggcgcgctggcgctgcatctgctggaccacggggtc
gccgtcgtgccggcctctgcctttggcggcgcgcattgcgggctgtccggcttccgcatc
agcttcgcggcgggcgaggacacattgcgcgaagccctgcaacgcatcgaaacggcggtc
accaagctatga

DBGET integrated database retrieval system