KEGG   Croceicoccus marinus: A9D14_12310Help
Entry
A9D14_12310       CDS       T04890                                 

Definition
(GenBank) anion permease
  KO
K07090  uncharacterized protein
Organism
cman  Croceicoccus marinus
Brite
KEGG Orthology (KO) [BR:cman00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    A9D14_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ARU16812
UniProt: A0A1Z1FDJ3
LinkDB All DBs
Position
2588398..2589159
Genome map
AA seq 253 aa AA seqDB search
MAAEFLADLVPFIIVGFAAQLVDGALGMAFGVICNSLLVGVLGFPPALASAKVHLVECFT
TGASGISHLAHRNIDKSLFFRLAGAGVLGGVAGAYLLSNIDAAIVKPIVLAYLAIIGLWL
IVRGVLYPPEAKPARFVAPLGAVGGFLDAAGGGGWGPVVTSNLLVQGVEPRRVIGTVSAA
EFFLTVAISITFISQIGLADLAGATLGLVIGGVCAAPIGAYAAKRIPIKPLLIFVGVVLT
ITSIVGIVTALRG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgaatttctggccgacctcgttcccttcatcatcgtcggatttgccgcgcag
ctggtcgacggcgcgctgggcatggcgttcggcgtcatctgcaattcgctgctggtgggc
gtgctgggctttccgcccgcgctggcgtcggccaaggtgcatctggtcgaatgcttcacc
accggggcgagcgggatcagccatctggctcatcgcaatatcgacaagtcgctgttcttc
cgcctggcgggagcgggcgtgctgggcggagtggcgggcgcctatctgctcagcaacata
gacgcggcgatcgtgaagccgatcgtgctggcctatctggcgatcatcggcctgtggctg
atcgtgcgcggcgtgctctatcccccagaggcgaagccggcgcgcttcgtcgcgccgctg
ggggccgtgggcggtttcctcgacgcggcgggcggcggtggatgggggccggtggtcacc
tctaacctgctggtgcagggcgtggagccgcgccgcgtgatcggcacggtcagcgcggcg
gagttcttcctgacggtggcgatctcgatcaccttcatctcgcagatcgggctggcggat
ctggcgggcgcgacattggggctggtgatcggcggcgtgtgcgcggccccgatcggcgcc
tatgccgccaagcgcattccgatcaagccgctgctgatcttcgtcggcgttgtgctgacg
atcaccagcatcgtgggcatcgtgacggcgctgcgggggtga

DBGET integrated database retrieval system