KEGG   Croceicoccus marinus: A9D14_12995Help
Entry
A9D14_12995       CDS       T04890                                 

Definition
(GenBank) MFS transporter
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
cman  Croceicoccus marinus
Brite
KEGG Orthology (KO) [BR:cman00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cman02000]
    A9D14_12995
Transporters [BR:cman02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    A9D14_12995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4 Sugar_tr Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: ARU16916
UniProt: A0A1Z1FDW8
LinkDB All DBs
Position
complement(2735521..2736720)
Genome map
AA seq 399 aa AA seqDB search
MTQPSTRSASPAWVLFALAMGAFAIGTTEFAAMSLVPFFAADLGITEVEAGHAISAYALG
VVVGAPLIAIFGARIRRRSLLMGLMGLFAIANALSALAPDYRSLLVFRFLSGLPHGAYFG
VAALVAASLVPVNRRAKAVALVMSGLTVATVIGVPVANWLGQLFGWQSGFLVVALLALLT
VTLVALLAPNEPADTGASPLRELGALRRPQVLLTLASGAIGFGGMFAVYTYVASTMIEVT
GLSERSVPLVLGIFGVGMTLGNLGGAHLADKARDRTAMGMLLWSAVMLAIYPFVAANPVG
LGIIVFLIGMGGGVGSVMQVRLMDVAGDAQTLAAAAHHSAFNTANALGPWLAGMAIAAGY
GLTSAGFIGSALALGGLAIYVVAVLLERSEKARLAATIC
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacccagccatcgaccagatccgccagccctgcgtgggtgctgttcgccctcgccatg
ggggcctttgccattggcaccaccgaattcgcggcgatgagcctagtgcccttcttcgcc
gccgacctcggcattaccgaggtggaggcgggccatgcgatcagcgcctatgcactgggc
gtggtggtcggcgcgccgctgatcgccattttcggcgcgcgcatcaggcggcggtcgctg
ctgatgggcctgatgggcctgttcgcgattgccaacgcgctcagcgcgctggcgccggac
taccgatcgctgctggtgttccgcttcctgtccggcctgccgcacggcgcctatttcggc
gtggcggcgctggtcgcggcctcgctggtgcccgtcaatcgccgcgccaaggcggtcgcg
ctggtgatgtcggggctgacggtggcaacggtgatcggcgtgccggtggcgaactggctg
ggccagctgttcggctggcagagcggcttcctggtcgtcgcgctgctggcgctgctgacg
gtcacgctggttgcgctgctggcaccgaacgaacccgccgataccggggccagccctttg
cgcgaactgggtgcgctccgccgaccgcaggtgctgctgacgctggcgtcgggcgcgatc
ggatttggcgggatgttcgcggtctatacctatgtcgcatcgaccatgatcgaggtcacg
ggcctgtcggagcggtcggtcccgctggtactggggatattcggcgttggcatgacgctg
ggcaatctcggcggcgcgcatctggccgacaaggcccgcgaccggaccgcgatgggcatg
ctgctgtggagcgcggtgatgctggcgatctatcccttcgtcgcggcgaatccggtgggg
cttggcatcatcgtcttcctgatcggcatgggcggcggcgtcggcagcgtgatgcaggtg
cggctgatggacgtggcgggcgatgcgcagacgctggccgccgccgcgcatcacagcgcg
ttcaacaccgccaatgcgctggggccgtggctggcgggcatggccatcgcggcgggttac
gggctgacctcggcggggttcatcggatctgcgctcgcgctgggcgggctggcgatctat
gtggtcgccgtcctgctggagcgcagcgaaaaggcgcggctggcggccaccatctgctga

DBGET integrated database retrieval system