KEGG   Croceicoccus marinus: A9D14_14305Help
Entry
A9D14_14305       CDS       T04890                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cman  Croceicoccus marinus
Brite
KEGG Orthology (KO) [BR:cman00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A9D14_14305
Enzymes [BR:cman01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A9D14_14305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_binding_3 FAD_oxidored AlaDh_PNT_C Thi4 NAD_binding_7 NAD_binding_8 Spermine_synth Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ARU17121
UniProt: A0A1Z1FE82
LinkDB All DBs
Position
complement(2998511..3000118)
Genome map
AA seq 535 aa AA seqDB search
MLEANLKQQLKQYLENLREPIELVASLGEGKKSDDTRELLNEIAELNDKVSASFEGNDAR
KPSFIIRRASDPQKWVRFAGLPLGHEFTSLVLALLWAGGHPPKVEQDVLDQIERLEGDFD
FEMYFSLSCHNCPDVVQALTLMALYNPHINATLIEGGTYQDEVEERGVMAVPATFLNGEM
FASGKMNVEEILAKVDSGAGAKAAEKIAGKTPFEVLIVGGGPAGASAAVYTARKGFSTGI
AAERFGGQVLDTMGIENFISVPYTEGPKLSAALEQHVGEYDIDVMNLQTAERLIPASQPG
GMHEVVLANGASLKARSLILTTGARWRNLGVPGEMDYRNKGVAYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLANIVGHVTLIEFDSKLRADQVLVDKLRSMKNVDILTSAATTEILGD
GERVSGLEYKNRETNELHKVELQGVFIQIGLVPNTEWLKESGLELSKHGEIVTDARAATN
LPGVFAAGDATNVPYKQIIISMGQGATAGLSAFDYLIRTEPADEIAQAEKVAQPA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagccaatctgaagcagcagcttaagcaatatctcgaaaacctgcgtgagccg
atcgaactcgttgcctcattgggtgagggcaagaagtccgacgacacgcgcgaattgttg
aacgaaatcgccgagctgaacgacaaggtcagcgcgtccttcgaaggcaatgacgcccgc
aagcccagcttcatcattcgccgcgccagcgacccacagaaatgggtgcgcttcgcaggc
ctgccgctgggccatgaattcacctcgctcgtccttgccctgctgtgggccggcggacac
ccgcccaaggtggagcaggacgtgctggaccagatcgaacgccttgaaggcgatttcgat
ttcgagatgtatttctcgctgtcctgccacaattgccccgacgtggtgcaggcgctgacg
ctgatggcgctctacaacccgcacatcaacgccaccctgatcgagggcggcacctatcag
gacgaagtcgaggaacgcggcgtcatggccgtgcccgccaccttcctgaacggcgagatg
ttcgccagcggcaagatgaatgtcgaggagatcctcgccaaggtcgacagcggcgcgggc
gccaaggcggccgagaagatcgcggggaagacaccgttcgaagtgctgatcgtgggcggc
ggccccgccggcgcctcggcggcggtctataccgcgcgcaagggcttctccaccggcatc
gcggccgagcgtttcggcggtcaggtgctcgacaccatggggatcgagaacttcatctcc
gtcccctataccgaggggcccaagctgtccgcggcgctggaacagcatgtgggcgagtac
gacatcgacgtgatgaacctgcagacggcggaaaggctcatcccggcctcgcagcccggc
ggcatgcacgaggtggtgctggccaatggcgcatcgctcaaggcccgcagcctgatcctg
accaccggcgcgcgctggcgcaacctgggcgttccgggcgagatggactatcgcaacaag
ggcgtcgcctattgcccgcactgcgacggtccgctgttcaagggcaagcatgtcgcggtc
atcggcggcggcaattcgggcgtcgaggcggcgatcgacctcgccaatatcgtcggccat
gtcacgctgatcgaattcgacagcaagctgcgcgcggaccaggtgctggtcgacaagctg
cgctcgatgaagaacgtcgacattctcacctcggccgcgacgaccgagatcctgggtgat
ggcgaacgcgtctccggcctcgaatacaagaaccgcgagacgaacgagctgcacaaggtc
gagctgcagggcgtcttcatccagatcgggctggtccccaacaccgaatggctgaaggaa
tcgggcctcgaactgtcgaagcatggcgagatcgtcaccgacgccagggccgcgaccaac
ctgccgggggtgttcgcggcgggcgatgcgaccaacgtgccctacaagcagatcatcatc
tcgatggggcagggcgcgaccgcggggctttcggccttcgactacctgatccgcaccgaa
cccgcggacgagatcgcgcaggccgaaaaggtggcccagcctgcctga

DBGET integrated database retrieval system