KEGG   Croceicoccus marinus: A9D14_16600Help
Entry
A9D14_16600       CDS       T04890                                 

Definition
(GenBank) dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cman  Croceicoccus marinus
Pathway
cman00010  Glycolysis / Gluconeogenesis
cman00020  Citrate cycle (TCA cycle)
cman00620  Pyruvate metabolism
cman01100  Metabolic pathways
cman01110  Biosynthesis of secondary metabolites
cman01120  Microbial metabolism in diverse environments
cman01130  Biosynthesis of antibiotics
cman01200  Carbon metabolism
Module
cman_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9D14_16600
   00020 Citrate cycle (TCA cycle)
    A9D14_16600
   00620 Pyruvate metabolism
    A9D14_16600
Enzymes [BR:cman01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A9D14_16600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ARU17936
UniProt: A0A1Z1FGT6
LinkDB All DBs
Position
pCME4A9I:515763..517199
Genome map
AA seq 478 aa AA seqDB search
MGKIRAFTMPKWGIEMTEGTVAEWKFAEGDSFSRGELICLIETAKITNEVEAEYDATVRR
IVVADGGEAEPVGALLAVFDDGSASDEEIDAFVANFKPAQGGVAEGREKKQQAKPKEAAI
EGESDKPKAITIDTNRPISPEARRLAEAEGVDIADIEGSGRGGRITFQDVQQALRGPASP
SLKGTTVLPGEDGAFASPLARRIAAIHGIDLNGVSGTGARGRISKKDVLAKVPQDTGSAA
PAPGAPFVPVANEPDIQPFDKIRKVVAKRLTAAKQDIPHFYLRISVNADALLAVRKTANM
VLGTKASVNDFIVMASAKALARHRDVNVQLHGEEIHSFPHADISVAVASPKGLVTPIVRQ
ADRMRIDQIASATRGLIDKAKEGRLGYEDMDGGTFTVSNLGMFGIDNFDAIINPPQGAIL
AVGAAERRLVEDERGEAVFATMIPMTLSVDHRAIDGAAGAQFLQTLKTLMEDPEQLFA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagatccgtgcctttacgatgccgaaatggggcatcgaaatgaccgagggaacc
gtcgccgaatggaaattcgccgagggtgacagctttagccggggcgagctgatctgcctg
atcgagaccgccaagatcaccaacgaggtcgaggccgaatatgatgcgaccgtgcgccgc
atcgtggtcgcggacgggggcgaggcggagccggtcggcgcgctgctggcggtgttcgac
gacggttcggccagcgacgaggaaatcgacgcgttcgtcgcgaacttcaagcccgcccag
ggcggcgtggccgaggggcgcgagaagaagcagcaggccaagcccaaggaagcggcaatc
gagggcgaaagcgacaagcccaaagccatcaccatcgacaccaaccgcccgatcagcccc
gaggccaggcggctggccgaggccgagggcgtcgacatcgccgatatcgagggatcgggc
aggggagggcgcatcaccttccaggacgtgcagcaggcgctgcgcggccccgccagcccc
agcctgaagggcaccaccgttctgcccggggaagacggcgcgttcgcatccccgctggcg
cggcgcatcgcggcgatccacggcatcgacctgaacggcgtttcgggcacgggtgcgcgc
gggcgcatttcgaagaaggacgtgctggcgaaggttccgcaggacacgggttccgcggcg
ccggcgccgggcgcgcccttcgtgccggtggcgaacgagcccgacatccagcccttcgac
aagatccgcaaggtggtggccaaacgcctgaccgcggccaagcaggacattccgcatttc
tacctgcggatcagcgtcaatgccgacgccttgctggcggtgcgcaagaccgcgaacatg
gtgctggggacgaaggcgtcagtcaacgatttcatcgtcatggccagtgccaaggcgctg
gcgaggcaccgcgacgtcaacgtgcagcttcacggcgaggagatccacagcttcccccac
gccgatatctccgtcgcggtggcgagccccaagggcctcgtcacccccatcgtgcggcag
gccgaccggatgcggatcgaccagatcgccagcgcgacgaggggcctgatcgacaaggcc
aaggaagggcgtctggggtacgaggacatggacggcgggacttttaccgtctcaaacctc
ggcatgttcgggatcgacaatttcgacgccatcatcaacccgccgcagggcgcgatcctg
gccgtgggcgctgccgagcgcaggctggtcgaggacgagcgcggcgaggcggtctttgcc
acgatgatcccgatgaccctgtcggtcgaccaccgcgccatcgacggggcggcgggcgcg
cagttcctgcagacgctgaaaaccctgatggaagatcccgagcagcttttcgcctga

DBGET integrated database retrieval system