KEGG   Celeribacter marinus: IMCC12053_1019Help
Entry
IMCC12053_1019    CDS       T04098                                 

Definition
(GenBank) hypothetical protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cmar  Celeribacter marinus
Pathway
cmar00630  Glyoxylate and dicarboxylate metabolism
cmar01100  Metabolic pathways
cmar01120  Microbial metabolism in diverse environments
cmar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC12053_1019
Enzymes [BR:cmar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     IMCC12053_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALI54967
UniProt: A0A0P0A8X5
LinkDB All DBs
Position
1019583..1020842
Genome map
AA seq 419 aa AA seqDB search
MSARQINVTYRLETSGDIAALAAKIASDQSTGTFTELPNETADVRARCAARVASITPLPH
SDTPAIPDPNGHGPYHRADVVISYPMDAVGTDIAALVTITIGGVYAVKGLSGVRVMDIDL
PPEWSCHPGPQFGMQGSRDLMGVTDGPMIASIIKPSLGLLPDATAEVVAQLCAAGVDFIK
DDEKLMSPAYSPLEARVKAIMPVIRAHEDKTGKRVMYAFGISAADPDTMMRNHDIVRAHG
GTAAVVNINSIGYGGMSFLRKRSELCLHAHRNGWDILTRHPRLGMEFRAYQKLWRLLGVD
QFQINGIRAKYWEPDDSFVQSFKDVTTPIFSPKDCPLPVVCSGQWGGQAVDTFKRTGGSL
DLMYLAGGGVHGHPMGMAAGVRAIRQAWDAASTGQTLIDYAKDHPELAAALRKWGDTSQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacgtcagatcaatgtcacctaccggctcgagacatcgggtgacatcgctgcg
ctcgccgcgaaaatcgcatcggatcaatcgaccggaaccttcaccgaattaccaaatgaa
acggcagatgtcagagcgcggtgcgccgcgcgggtcgcctccatcacgcccctgccccat
agcgacacccccgcgataccggacccgaacggtcatggcccatatcaccgcgcggacgtc
gtgatctcctatccgatggacgccgttggcaccgacatcgcagcccttgtgacgatcaca
atcggtggggtctatgccgtcaaagggctttcgggcgtgcgcgtgatggacatcgacctg
ccgcctgaatggtcctgtcaccccggcccacagttcggcatgcaaggttcgcgtgacttg
atgggggtcacagacggcccgatgatcgcgtccattataaagccctcgctcgggttgctg
cccgatgccaccgccgaggtggtggcgcagttgtgcgcggcgggcgtcgacttcatcaag
gacgacgaaaaactgatgagccctgcgtattcgcctcttgaggcgcgcgtcaaagcgatc
atgcccgtgatccgtgcccacgaggacaaaacgggcaaacgcgttatgtacgcgtttggc
atttccgccgccgatcccgacaccatgatgcgcaaccacgacattgtgcgcgcacatggc
ggcacagcagcggtggtgaatataaattccatcggctacggcggcatgagttttttgcgc
aaacgctccgagttatgcctacatgcacatcgcaatggatgggacatcctgacccgtcac
ccacgcctcggaatggaatttcgcgcctatcaaaaactctggcgacttttgggcgttgac
caattccagatcaacggcattcgcgccaaatattgggaacccgacgacagctttgtccaa
tcgttcaaagatgtgaccacgcccattttttcgcccaaagattgcccgctgcccgtagtg
tgttcgggccaatggggcggccaagcggtggacaccttcaaacgtacgggtgggtcactt
gacctgatgtatctggcaggcggcggagttcatggccacccgatgggcatggccgcaggc
gtgcgcgcaatccgtcaggcatgggacgcggccagcacaggacagacgctaatcgactat
gccaaagatcaccctgaacttgccgcggcattgcgcaaatggggcgacacttcccaatag

DBGET integrated database retrieval system