KEGG   Celeribacter marinus: IMCC12053_1037Help
Entry
IMCC12053_1037    CDS       T04098                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmar  Celeribacter marinus
Pathway
cmar00564  Glycerophospholipid metabolism
cmar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmar00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    IMCC12053_1037
Enzymes [BR:cmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IMCC12053_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Mqo
Motif
Other DBs
NCBI-ProteinID: ALI54985
UniProt: A0A0P0AAN6
LinkDB All DBs
Position
1037673..1039274
Genome map
AA seq 533 aa AA seqDB search
MDHTDPQNVIDLFVIGGGINGCGIARDAVGRGLSVELAEMNDLASATSSASTKLFHGGLR
YLEYWEVRLVREALIERETLLRAMPHISWPMRFVLPYHKDMRFEGDTPTSKLLSFIMPWM
KGRRPAWLIRLGLFMYDNLGGRKILKGTTSIALPGTAEGAPLNDRFKTAYEYSDCWIEDS
RLVVLNARDAEARGAKINVRTKVLSAEQSNGLWVVTLQDTDSGDTRTVHAKMLINAGGPW
VEDIIRNAVRINSSDGVRLVRGSHIVTRKLYDHDKCYFFQGEDGRIIFTIPYETDFTLIG
TTDMDHTALTDKPVCTDEERDYLLAFVSNYLKEPVTVDDVVWSYSGVRPLYNDGATSATA
ATRDYVLKVDQSTGAPMLNVFGGKITTYRKLAESALEKITPFFDHAGKPWTAGVALPGGN
FPVDGVAALTQKLADTYPFLSRAWATRLTKAYGTEAFEVLGQAKTKADLGHDFGADLTER
EVAWLMACEFAYSADDVVWRRSKLGLRLSQEEIKALDDWMSNAKSKPEQQGAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
ttggaccacaccgatcctcaaaacgttatcgacctgtttgtcatcggcggcggcatcaat
ggatgtggcattgcgcgtgatgcggtcgggcgcggtttgagtgtcgaactggctgaaatg
aatgacctcgcctcagcgacatcctccgcctcgacaaagctgtttcatggcgggttgcga
tatcttgaatattgggaagtccggttggtgcgtgaggcgcttattgaacgcgaaacgctt
ttgcgggcgatgccccatatctcttggccgatgcgatttgttttgccctatcacaaagac
atgcggtttgagggcgacacgccaacgtccaaactactgagttttatcatgccttggatg
aaagggcggcgtccggcgtggctcatccgtcttggcctgttcatgtatgacaaccttggc
gggcgaaaaatcctcaagggcacgacctctatcgccctgccgggaactgccgaaggtgcg
ccattgaatgaccgtttcaaaacggcctacgaatattcggattgctggatcgaagatagc
cgattggttgtgttgaacgcccgtgacgccgaggcgcgtggtgctaaaatcaacgtcagg
acgaaagtgctgtcggcagagcaatcaaacggactttgggtcgtcacactccaagacacc
gacagtggagatacgcgcaccgtccatgccaaaatgctgatcaacgctggcggtccgtgg
gttgaagacattattcgcaacgccgtgcggatcaactcctcggacggcgtgcgcctcgtg
cgcggtagccacatcgtgacacgcaagctctatgaccacgacaaatgctatttcttccaa
ggcgaagacggtcggatcattttcactattccctatgagaccgatttcacactgatcggc
accaccgacatggaccacacggcgctcaccgataagcccgtttgcaccgacgaagagcgc
gactatttgttggcctttgtgtcgaactacctcaaagagcctgtcaccgttgatgatgtc
gtgtggagctattcgggggtgcgcccgttgtacaatgacggtgcgacatcggccacggcg
gcgacacgcgactatgtgcttaaggtggatcaatcgaccggtgcgccgatgctcaatgtc
tttggtggcaagatcaccacctaccgcaaacttgcggaatccgcgctcgaaaaaatcacg
ccgttctttgatcatgcgggcaaaccgtggacggcgggcgtggcccttcccggcgggaat
tttcccgtcgacggagtggcggccttgacgcaaaagcttgcagacacctatccgtttttg
tcgcgcgcatgggcaacacgccttaccaaggcctacggaaccgaggcctttgaggttctc
ggacaggccaaaacgaaagccgatctggggcacgatttcggggcggacctaaccgagcga
gaagtcgcgtggttaatggcctgcgaatttgcctacagcgcagacgatgttgtttggcgg
cgctccaaattaggactgcgcctgtcacaagaagagataaaggcgctcgacgactggatg
tcgaatgcaaagagtaagccggagcagcaaggcgcagcctaa

DBGET integrated database retrieval system