KEGG   Celeribacter marinus: IMCC12053_1096Help
Entry
IMCC12053_1096    CDS       T04098                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cmar  Celeribacter marinus
Pathway
cmar00240  Pyrimidine metabolism
cmar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    IMCC12053_1096
Enzymes [BR:cmar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     IMCC12053_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: ALI55044
UniProt: A0A0P0AA84
LinkDB All DBs
Position
1093123..1093713
Genome map
AA seq 196 aa AA seqDB search
MAKLYFQYSTMNAGKSTLLLQASHNYRERGMDTYLMTAQFDNRAGEGRIGSRIGIGEAAD
TFAVGEDLFAKVEARLAQGKVACIFIDEAQFLTHEQVWQLARAVDDLGVPIMTYGLRVDF
QGHLFPGSAALLALADEMREVRTICHCGKKASMVVRTNEAGDVLTEGAQVEIGGNERYVS
LCRRHWRAAMGDTQAP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgtactttcaatactcgacgatgaacgcgggcaaatcgaccctgcttcta
caagcgtcccacaactaccgcgagcgcggcatggacacctatttgatgaccgcgcagttt
gacaatcgtgcgggcgagggccgcatcgggtcgcgcatcggtattggcgaggcggcagat
acctttgccgttggcgaagatctttttgcaaaggttgaggcgcgtctggcgcagggcaaa
gttgcgtgtatctttatcgacgaagctcagtttttgacccatgaacaggtttggcaactg
gcgcgtgcggttgatgatttgggcgtgccgatcatgacctacgggctacgggtcgatttt
caggggcatttgttccccggctctgccgcgctcttggcgcttgccgatgaaatgcgcgag
gtgcgcacgatctgtcattgcggcaagaaggcatcgatggtcgtgcgtacaaatgaggcg
ggcgatgtgttgaccgagggcgcacaggtcgaaattggcggcaacgagcgatacgtctcg
ttgtgccgccgtcattggcgcgcggccatgggcgatacgcaagccccttaa

DBGET integrated database retrieval system