KEGG   Celeribacter marinus: IMCC12053_2224Help
Entry
IMCC12053_2224    CDS       T04098                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
cmar  Celeribacter marinus
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IMCC12053_2224
Enzymes [BR:cmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     IMCC12053_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 PrmA MTS DUF43 Staphylcoagulse
Motif
Other DBs
NCBI-ProteinID: ALI56171
UniProt: A0A0P0A6A1
LinkDB All DBs
Position
2161256..2162287
Genome map
AA seq 343 aa AA seqDB search
MKALYAHGPRDLQLGSCDIDDPQAGEVRIKMARGGICGSDLHYFLHGGFGTVRLREPMVL
GHEVSGHVTAIGEGVDGLAVGDLVAVSPSRPCGACEECARGNANHCANMRFYGSAMPFPH
IQGAFREEIVAMQSQCVKAEGLTPAEAATAEPLAVVLHALHQAGDLLGKRVLVTGCGPIG
LLTILAARRAGAADIIATDISDRGLEFARNAGANVTVNTMTHADGLAVYGAGKGTLDVLF
ECSGAQVALAGAIPAIRPKGVIVQVGMSGDMTLPMQQITVKELALKGSFRFHPEFATAIS
LMQQKLIDVTPLITHSFPLEQFQEAFDTATDREKAMKVQLVFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctttatgcccacggaccccgcgatttacagttgggatcgtgcgatattgat
gatccacaagcgggcgaagtacgcattaaaatggcacgcggcggcatttgcggctctgat
ttgcactactttttgcatgggggattcggcacggtgcgtttgcgcgaaccgatggttttg
ggtcacgaagtctctgggcatgtcaccgcaatcggagagggcgtcgacggtttggccgtg
ggcgatctggtcgccgtatcgccttcgcgcccgtgcggcgcatgcgaggaatgcgcacgc
ggcaacgccaatcattgcgccaacatgcgcttttacggctccgcgatgccatttccccat
atccaaggcgcatttcgcgaagagattgtagcgatgcaaagccaatgcgtgaaagccgag
ggactaacccccgccgaagccgccacagccgaacctttggccgttgttttgcacgccctg
caccaagcgggcgatctattgggcaaacgcgtgttggtgacgggatgcggccccatcggg
ttgctcaccatccttgcggcgcgccgcgcaggggcggctgatattatcgcgacagacatc
tctgaccgtggacttgaattcgcgcgcaacgcgggtgcgaatgtgacggtgaacaccatg
acccatgcggacgggcttgcggtctatggcgcgggcaaaggcacactcgatgtgctgttt
gaatgctcgggcgcgcaggtggcattggcgggtgcgatccccgcgatccgtcccaaaggc
gtgattgttcaggtcggcatgtcgggcgatatgaccctgccgatgcaacaaatcaccgtc
aaagaactcgccctcaaaggctcgttccgctttcatcccgaatttgccaccgcgatttcc
ctgatgcagcaaaagctgatcgacgtgacgccgctcatcacccacagcttcccgcttgag
cagttccaagaggcgtttgacaccgcaacggatcgcgaaaaagcgatgaaagtgcaactg
gtgtttggctga

DBGET integrated database retrieval system