KEGG   Cucurbita maxima (winter squash): 111465415Help
Entry
111465415         CDS       T05246                                 

Definition
(RefSeq) uncharacterized protein LOC111465415
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00270  Cysteine and methionine metabolism
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    111465415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cmax03032]
    111465415
   03036 Chromosome and associated proteins [BR:cmax03036]
    111465415
Enzymes [BR:cmax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     111465415
DNA replication proteins [BR:cmax03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    111465415
Chromosome and associated proteins [BR:cmax03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111465415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP
Motif
Other DBs
NCBI-GeneID: 111465415
NCBI-ProteinID: XP_022965542
LinkDB All DBs
Position
Unknown
AA seq 1217 aa AA seqDB search
MISVMNKDFEFEKKSDDGLEESRAEDIDLEHAADSSSHDDQVSDSRVVKEARVSLMELDP
GAPGSEFDAKMLGNGRSAEFRVFPSEEVGFLVSSDGEGGGPGMDMKFSSSLVDVKISKTD
RFDGSVGHLDAQNDRKSNLSQYKFLMSEFDDYVANESSGAMVAAATSRAMSYGFEVGDMV
WGKVKSHPWWPGHIFSDSLASPSVRRTRRDGYVLVAFFGDSSYGWFDPAELIPFEPNYYE
KSRQTTSRTFLKAVEEAVDEASRRRGLGLACKCRNRYNFRQTNVPGYFAVDVPDFEVGGV
YSWNQIRRARDSFKPSETLSFIKQLALTPRGGDHRSINFVNNKATVFGYRRAVYEEFDET
YAQAFGPPSGPGRPPRSSVASLDQHREPARAPLSGPLVIAEALGAGKSAIKPMKLKDQSK
KDRYLLKRRDEPSNLIDFGANQEQATSTVPSSLVTESAKTGVAEDYVLLKRTPTVPVKPQ
IQVKGDHTAFGTDSETSSLSLPSNEAEIGRMALGTNLTTSQGLSTSIEASSDKRTIPLEE
PKETMAPSEDVGLRNDAFSDIADERAVPRMLVDTEPLRDQSDALREVRYAGTENILKSSG
TPQQLELSNSVSLEGDHTSDRNLDSHVNAEPSSAGAKFADVNSSVGGVLKPKVLKRPAED
ISSTGTPIMGVKKKKKKKRDIGAEMGSEHVQKLMALKKAGNLVGKVAEKSNQVGLGSRED
FRSTYEKKSTASTNSISHASGLPGFGRGSDEFDVPQLLNDLQAFALDPFHGVERNCQVIV
QKFFLRFRSLVYQKSLISSPSSEAESTDLRAVKSPDASLGTDNLSENIRDQSVKPLLRHD
DRTKAGRKRVPSDRLEEIAAKKLKKMSDLKSLAAEKKATQKLADSQKRESRDSVVPTTTI
KTVKRDSAKKLVPPSVRKVDPTMLVMKFPPETSLPSMNELKARLGRFGPIDQSGLRIFWK
TSTCRVVFLYKPDAQAAYKYAMGNKSLFGNVNVKYQLREVGTPVAETPESEKGSATTDDN
PIEAPRMKDPMVVLPGRASSIPVVHQPPLLPLPTVQLKSCLKKTSGDESGVPSVGTVGSS
SSKGTTRVKFMLDGDESNRNIMNANFADGGTSPSVAMDINSNFFQKVVSTPPLPIPTNIM
HQQHSEMPQPRNALNHHNHHHHHLHHHTPTMAPPPTTTTTPTPTTDISQQLLSLLSRCSD
VVTNVTGLLGYVPYHPL
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgatttcggtgatgaataaggattttgaattcgagaagaaatcagatgatggcctggaa
gagtcacgggcggaggatatagatctcgagcacgccgctgatagttcgagccacgatgat
caagtttctgattccagagttgttaaggaagctagggtttccttaatggagctggatccc
ggagctccggggagcgagttcgatgcgaagatgttgggaaatggtagatctgccgagttt
agggttttcccgtcggaggaggtggggtttttggttagttcggatggcgaaggaggaggc
ccaggtatggatatgaagttctcgagctctcttgttgatgttaaaatctcgaaaactgat
cgatttgatggttcagttggtcatttggatgcacagaacgatcgaaagtctaatttatct
cagtataagttcttaatgtctgagtttgatgattatgttgcgaatgagagcagtggtgca
atggttgcggcggcaacttcgagggcgatgagctatgggtttgaggtgggggatatggtg
tggggaaaggtcaagtctcatccgtggtggcctgggcatatttttagcgattctttggct
tctccttctgtgcgacgcaccaggagagatggatatgttttggtggcattttttggtgat
agcagttatgggtggtttgaccctgctgagctaatcccattcgagcctaactattatgag
aaatctagacagacaacttcaaggacctttttgaaggctgtggaagaggcagtcgatgaa
gcgagtcggagacgaggtcttggtctagcctgcaaatgtaggaatcgttacaattttagg
cagacgaatgttccgggatacttcgctgttgatgttccagattttgaggtaggaggtgtt
tactcttggaatcagattaggagggcgagagatagttttaaacccagtgaaactctctca
tttatcaagcaattggcattgactccacgaggtggtgatcatagaagcattaactttgtg
aacaataaggctacagtcttcggttatcgaagagcggtttatgaagagtttgatgagaca
tatgctcaggcatttggtccaccatctgggcctggacgtccccctcgcagctcggttgct
tcattggatcagcatagagaaccagctcgagctcctttgagtggccccctagtgattgca
gaagctttgggggctgggaagagtgcaataaagcctatgaagttaaaggaccaatctaag
aaagacaggtacctactcaaacgtcgagacgaaccaagtaacttgattgactttggggct
aaccaggagcaggcaacttctaccgttccctcgtctctcgttacagaatccgccaaaact
ggggttgccgaagattatgttctgctgaagaggactccaactgttcctgtcaagcctcaa
atacaggtcaaaggtgaccacactgcgtttggtacggatagtgaaacttctagtctgagt
ttacccagcaatgaagctgagataggtaggatggccttgggcaccaatcttactactagc
caaggactttctacgagcatcgaggcatcttctgataagagaacgattcctctagaggaa
ccgaaggagacaatggcacctagtgaagatgtcggtcttaggaatgatgccttctctgat
atagcagatgagagggctgttccgagaatgttggtggataccgagcctcttcgtgaccaa
tcagatgctttacgtgaagttagatatgcaggtacagaaaatatcttgaaatcttctgga
actcctcaacaacttgagcttagtaattcagtgagtcttgaaggtgaccacacatcagat
agaaatttggacagccacgttaacgctgaaccttcgtctgctggtgcgaagtttgctgat
gtcaatagttcggttggcggagtcttgaagccaaaggtcctgaaacggccagctgaagac
ataagctccacaggcactccgattatgggggtgaaaaagaaaaagaaaaagaagcgagac
ataggtgcagaaatgggttccgagcatgtacagaaactgatggcattgaagaaggctggg
aacttagtcggaaaagttgcagaaaaatccaatcaggtcggtttgggttccagagaggat
ttccggtcgacatatgagaaaaaaagcactgcatcaactaattcgatatcacatgctagc
gggttgcctgggtttggccgagggagtgatgagttcgatgtgccccaactgttaaatgat
ttgcaagcctttgctctggatcctttccatggggttgaaaggaattgccaagtgatcgtt
cagaagttcttcctgcggtttcggtcactcgtttatcagaaaagtttgatttcgtcgcca
tcatctgaggccgagtccactgatcttcgtgcagttaaatctccagatgctagccttgga
actgataatttaagtgagaacattagagatcaatcagttaaacccttacttagacacgat
gatcgaacaaaggcagggcggaaacgtgttccatctgatcgtctagaggaaattgcagcc
aagaagttaaagaaaatgagtgatttgaaatcgttggcagcagagaaaaaggctacccag
aaactcgccgatagccagaaacgtgaatccagagattctgtagtaccgacgacgacaatc
aagacggtcaagcgagattctgcgaagaagttggtgcctccttcagtaaggaaagtcgat
ccaaccatgttggttatgaagttccctcccgaaacatcacttccatccatgaacgagcta
aaggctaggctcggtcgattcgggccaatcgaccaatcaggtctccgtatcttctggaaa
acatcaacatgtcgtgtcgttttcctctacaaaccggatgctcaagcagcctacaagtat
gcaatgggaaacaagtccttatttgggaatgtcaacgtaaagtaccaacttcgagaagta
ggaactcctgtagccgaaacacccgaatccgagaagggaagtgcaacaacagatgacaat
cctatcgaagcccccaggatgaaggatccaatggtcgtcctaccaggacgagcatcatca
atcccagtggtacatcaaccaccccttctaccactcccaacagttcagctcaaatcctgc
ctgaaaaagacatcaggtgacgaatccggtgtaccgagtgtcggcacggtaggcagcagc
agcagcaaaggaacgacacgagtgaagttcatgttggacggcgacgaaagtaatagaaac
atcatgaatgctaatttcgcagatggtggaacatctccttctgttgcaatggatattaat
agtaacttctttcaaaaggtcgtttctacacctcccctcccaattcctacaaatattatg
catcaacaacactcggaaatgccacaacctagaaatgcactcaaccaccacaaccaccac
caccaccacctccaccaccacacacccaccatggcaccaccgcccaccaccaccactacc
ccgaccccgaccaccgacatttcccagcagctgctgagccttttatcaaggtgcagcgat
gtggtcaccaatgtcacaggcttgttaggctatgtgccataccaccctctttga

DBGET integrated database retrieval system