KEGG   Cucurbita maxima (winter squash): 111465984Help
Entry
111465984         CDS       T05246                                 

Definition
(RefSeq) protein GLUTAMINE DUMPER 3-like
Organism
cmax  Cucurbita maxima (winter squash)
SSDB OrthologParalogGFIT
Motif
Pfam: Zip
Motif
Other DBs
NCBI-GeneID: 111465984
NCBI-ProteinID: XP_022966276
LinkDB All DBs
Position
Unknown
AA seq 172 aa AA seqDB search
MAASREPFNVLPHSAAPAANLQQQQHSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWK
LSGYLDSGDANNREPDLEAGDDTRKPSPVFEEKLLVIMAGEIKPTYLATPMSSRSSSFGD
TKSNSSSSATATDEKDEKSVAVTETVKQSSGEEEVQSTENRETPESSDQTTH
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcggccagcagagagcccttcaacgtgttgccgcactcagcagcgccggcggctaac
ctacagcaacaacagcactccccttggcattcccctgtcccctacttgttcggtggtttg
gctgcgatgttaggactcatcgcttttgcgcttctaatcctcgcttgctcatactggaaa
ctttctggctatctcgacagtggtgacgctaacaaccgggagcccgacctggaggccggc
gacgacacccggaaaccctcccctgtttttgaagagaaactcttggttattatggccggt
gaaatcaagcccacatatttagctactcccatgtcaagcaggtcctcttcttttggggat
acgaaaagcaatagtagtagcagcgctacggccaccgacgagaaagatgaaaaatcagtg
gccgtaacggagacggtgaaacagagcagtggagaagaggaggtgcagagtacagaaaac
agagaaactcctgaatcttcagatcagacgacccattaa

DBGET integrated database retrieval system