KEGG   Cucurbita maxima (winter squash): 111476734Help
Entry
111476734         CDS       T05246                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00500  Starch and sucrose metabolism
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111476734
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     111476734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 Nod_GRP
Motif
Other DBs
NCBI-GeneID: 111476734
NCBI-ProteinID: XP_022976296
LinkDB All DBs
Position
Unknown
AA seq 426 aa AA seqDB search
MGFLASLCFLCYLSVFIFPSPSFSSTLLFQGFNWESSSKGGWYNSLNNIIPDLVHAKVTH
VWLPPPSQSASPQGYLPGRLYDLNASKYGTQDELKSLIAALHNNGIKAVADIVINHRTAD
KQDERGIWCIFEGGTPDSRLDWGPSFICSDDTEYSDGKGNPDSGEPYSAAPDIDHLNPQV
QNELSEWMRWLKTEIGFDGWRFDFVKGYAPKITKLYMDQTSPDFAVGEKWDSLSPGPDGK
PDPNQDGHREALANWVRDSGDTVTAFDFTTKGILQAAVQGELWRLKDPNGKPPGFIGIKP
ESAVTFIDNHDTGSTQKLWPFPSDKVIQGYAYILTHPGTPSIFYDHFVEWGLKEELIKLS
AIRTRNGIGERSTVNIMASDGDLYVAGIDGKIIMKIGPNTNLGNLIPSDYELATSGMQYA
VWEKKK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcctagcttctctgtgcttcctctgctacctctctgttttcatcttcccatcc
ccctctttttcttctaccttactgtttcagggcttcaactgggaatcgagtagcaaagga
ggatggtacaactcactcaacaacatcattcctgacctggtacatgctaaagttactcat
gtctggcttcctccaccctcccaatcagcttctccacaaggatacttacccggaaggctt
tatgatctgaatgcatccaaatacggaacccaggatgaactcaagtccctcatcgccgcc
ctccacaataatggaatcaaagccgtagccgacatagtgatcaaccacagaacagcagat
aaacaggacgagagaggaatttggtgcatttttgaggggggaactccagatagccgcctt
gattggggtccttccttcatttgcagcgatgacactgaatattccgatggaaagggcaat
ccagacagtggggaaccctattcagcagcacctgatattgaccatctcaacccacaggtt
cagaatgaattatcagaatggatgagatggttgaaaacagaaatagggttcgatggatgg
agattcgactttgtaaagggctatgcaccaaaaattacaaaactctacatggatcaaacc
tcgccagatttcgcagtcggtgagaaatgggattcactttcacctggaccggacgggaag
cccgatccaaaccaagacggacatcgcgaagctcttgcaaactgggttagggattcgggc
gatactgtcacagcgtttgatttcacaaccaaaggtattcttcaagctgccgttcagggg
gagctatggaggttgaaggatcctaacgggaagccgccgggattcatcggaatcaagccg
gaaagtgccgtaactttcatcgacaaccacgacactggttcgacgcaaaaactctggccg
ttcccttccgataaagtgattcagggatatgcgtacattctcacgcatcctggaacgccc
tccattttctacgaccatttcgttgaatggggattgaaggaggagctaatcaaattgagc
gcaatcaggacaaggaatgggattggggaaaggagcacggtgaatattatggcttctgac
ggcgatctatacgttgctggtattgatgggaaaattataatgaagatcggaccgaacacc
aatcttggaaatctgattccgtcggattacgagcttgccacttctggaatgcagtatgct
gtctgggagaaaaagaaatga

DBGET integrated database retrieval system