KEGG   Cucurbita maxima (winter squash): 111476821Help
Entry
111476821         CDS       T05246                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00620  Pyruvate metabolism
cmax00710  Carbon fixation in photosynthetic organisms
cmax01100  Metabolic pathways
cmax01200  Carbon metabolism
Module
cmax_M00168  CAM (Crassulacean acid metabolism), dark
cmax_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cmax_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cmax_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111476821
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111476821
Enzymes [BR:cmax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111476821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
Other DBs
NCBI-GeneID: 111476821
NCBI-ProteinID: XP_022976406
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MPNRNVEKMASIDAQLRLLAPARVSDDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGVFADENSATTESDIEETLKKLVGKLNKSPQEVFDALKNQTIDLVLTAHPTQSVRRS
LLQKHARIRDCLVQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCSSELRERADVLHNSSRRDAKHYIEFWKQVP
ANEPYRVILGDVRDKLYQTRERSRHLLANGYSDIPEDATFTNVEQFLEPLELCYRSLCAC
GDRPIADGTLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLEAITQHLDIGSYKEWSEKQR
QEWLLSELSGKRPLFGPDLPTTEEISDVLNTFHVIAELPSDNFGAYIISMATAPSDVLAV
ELLQRECHVTQPLRVVPLFEKLADLEAAPAALARLFSIDWYKDRINGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRTLMDEMAVVATE
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIQKDVKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEDLWPFGQRLRANYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNACQA
YTLKRIRDPNYHVTTRPHISREIMEASKPADELVKLNPKSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaccgaaatgttgagaaaatggcatcgattgatgcgcagcttcggcttttagca
ccagctagagtgagtgatgatgataaattggtggagtatgatgcgttgttgctggatcgg
ttccttgatattcttcaggatttgcacggggaggatctgaaggaaactgtgcaagagtgt
tatgaactttctgctgaatatgaagggaaacacgatccgaagaaactcgaggagctcgga
aatgtgctgactagtttagatccaggggactctattgtcattgccaaatctttttcccat
atgcttaatttggcgaacttggccgaggaggttcagattgcttatcgtcgaaggatcaaa
ctgaagaagggagtttttgctgatgagaactctgcaaccacggaatctgacatcgaagaa
actctgaagaagcttgtggggaaactgaataagtcccctcaagaagttttcgatgccttg
aagaaccagactatagatttggtcttaactgctcatccgactcaatcagttcgtagatct
ttgcttcagaagcatgcaaggatacgggactgtttagttcagttgtacgccaaagacatt
actcccgatgacaagcaagaacttgatgaggcacttcagagagagattcaagctgcattt
cgtactgatgaaatccgtagaactcctcctaccccacaagatgaaatgagggcaggaatg
agctacttccacgagacaatttggaagggtgttcctaaatttctgcgccgtgttgatact
gctttaaaaaacatagggatcgatgaacgtgttccttataatgcaccactaattcagttt
tcatcttggatgggtggtgaccgtgatggtaatcccagggtgacaccggaggttacaagg
gacgtctgtcttcttgctagaatgatggctgctaatctgtactactcacagattgaggat
ctcatgtttgagttgtctatgtggcgttgcagtagtgagcttcgtgagcgtgcagacgtg
cttcataattcatcaaggagagatgcaaaacactatatagaattttggaagcaagttcct
gccaatgaaccctaccgagtgattcttggcgacgtaagggacaagctttatcagacgcgt
gagcgttctcgccatttgttagctaatggatattcggacatcccagaggatgcgactttt
acaaatgttgagcagttcttggaacctcttgaactatgctacagatccctctgtgcttgt
ggtgaccgaccgattgctgatggcacccttcttgattttttgaggcaagtgtccactttt
ggcttgtcacttgtaagacttgacatcaggcaggagtcagatcgtcacactgacgttttg
gaagccattactcagcatttggatattggttcctacaaagaatggtccgagaaacagcga
caagaatggcttctatcggaacttagtggcaaacgtcctctttttggtcctgatcttcct
acaactgaagaaatatctgatgttttaaacacgttccatgtcatagcggaacttccttct
gataacttcggtgcatatatcatttccatggccactgctccgtctgatgttttagcagtt
gagctattgcagcgcgagtgccatgttacgcaaccgttgagagttgttcccctgttcgag
aagcttgcagatttggaggctgcaccagcagcccttgctcgcctcttctcgatagattgg
tacaaagaccgaattaatggaaagcaagaagtcatgattggctactcggattctggtaaa
gatgctggacggttctctgcagcctggcagttgtacaaggctcaagaggagcttataaaa
gttgcaaagcaatatggtgtgaagctaactatgtttcacggtcggggtggcaccgttgga
agaggaggtggacctactcatcttgctattttgtcccaaccacctgagacaattcatggt
tcgctccgtgtaacagtacagggggaagttattgagcagtcctttggagaagagcacttg
tgttttcgaacactccaacgtttcactgctgcaacacttgagcatggaatgcaccctcca
gtttcaccaaaacctgaatggcgtacactgatggacgaaatggctgttgtagcgacagaa
gaataccgttccattgtcttccaagaaccacgatttgtcgaatatttccgccttgctaca
cctgagcttgagtatggtaggatgaatattggaagccgtccatcaaaacgaaagccaagc
gggggtatcgagtcacttcgtgcaatcccatggatctttgcatggacacagacgcgattt
catcttccagtttggttaggctttggagcagcattcaagcatattattcagaaagatgtt
aagaaccttcaaatgttgcaggagatgtacaacgaatggcccttctttagggtcaccatt
gatttggtcgaaatggtgttcgctaaaggagaccctggcatcgcagcgttgtacgataag
ctcctagtttcggaggacctctggccattcggacagcgcttgagagccaactatgaagaa
acaaagagccttctactgcagattgctggacacaaagatcttcttgaaggggatccttac
ttgaagcaaagactccgtctccgtgattcatacatcacgactctgaacgcttgccaagca
tacacactgaaacgaatccgtgatccgaactaccacgtgacaacgcgtccacacatttca
agggaaataatggaagcaagcaaaccagcagacgaactggtgaagctaaacccgaagagc
gagtatgcacctgggctagaggacactctgatcttgaccatgaagggtattgctgctgga
atgcagaacactggttaa

DBGET integrated database retrieval system