KEGG   Cucurbita maxima (winter squash): 111477870Help
Entry
111477870         CDS       T05246                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00010  Glycolysis / Gluconeogenesis
cmax00020  Citrate cycle (TCA cycle)
cmax00620  Pyruvate metabolism
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
cmax01200  Carbon metabolism
Module
cmax_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111477870
   00020 Citrate cycle (TCA cycle)
    111477870
   00620 Pyruvate metabolism
    111477870
Enzymes [BR:cmax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     111477870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 111477870
NCBI-ProteinID: XP_022977626
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MASSFLSRAALSSNTTAISFSFSSSISSPLPWSSSRSYTSFPANSRRRIPVVQSKIREIF
MPALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGET
APVGAPIGLLAETEEEVAEAKAKAASKSAAPSSPAAAVSPSPPPPSSSPAPATSQPSPPP
PTAASDGPRKTVATPQAKKLAKQHKVDIGSITGTGPFGRITPADVEAAAGIVPSKPAVSN
VASPVASGIAPVAAAAPTKAAAAPSNLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTFR
VGYPVSTDALDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNNNINI
AVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPNEYNSGTFTLSNLGMF
GVDRFDAILPPGQGAIMAVGASKPTVVTDADGFFSVKSKMLVNVTADHRIVYGADLAAFL
QTFAKIVENPESLTL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcgttcctctctcgtgctgctctctccagcaataccactgccatttcattt
tccttctcttcttccatctcttctcccctcccatggagctcttcccgttcatacacctcc
tttcccgctaattctcgtcggaggattcctgtcgttcaatccaagatccgcgagattttc
atgcctgccctaagctctaccatgactgagggaaagatcgtttcgtgggtcaaatctgaa
ggggacgttctatccaaaggagagagtgtcgtcgttgtggagtctgacaaggcggatatg
gatgtggagactttttatgatggaattctcgccgctattgttgttggagagggtgaaact
gcccctgttggagctcctattggtttattggccgagactgaagaggaggtcgctgaggct
aaggctaaagccgcgtcaaaatccgcggctccttcgtctcctgctgctgctgtttctccc
tctcctccgcctccctcttctagtcctgctccggcgacatctcagccatcgcctccgccg
cccacggctgcgtcggatggaccaaggaagactgtggctacccctcaggcgaagaagcta
gccaaacagcacaaggtggatattggatccataaccggtactggtccattcggtcgaatt
actccggcagatgtggaggctgcggcaggaattgtcccttcgaagcctgctgtaagcaat
gtggcttcacccgtggcctctgggattgctccagtggctgccgctgctccaacgaaagct
gctgcagctccttccaacttgcctcctccagttccgggctcaacggttgtgccattcacg
acaatgcaggcggcggtgtctaagaatatggtggagagtctctctgttcctacattccga
gttggttatccggtatccactgatgctcttgatgcgctctatgagaaggtgaaaccaaag
ggtgtcacaatgactgccctcctggccaaggctgctgcaatggccctcgctcagcatcct
gttgtaaatgcaagctgtaaagacggtaagagctttacgtataacaacaacataaatatt
gcagtagccgtggctatcaacggtgggttgataactcctgttcttcaggatgcagataag
ttggacctctacctactgtctcaaaaatggaaagaattggtagagaaagccagatccaag
cagcttcagcccaatgagtataattcaggaacttttactctttccaatctgggcatgttt
ggagtggacaggttcgatgctatacttcctcctggccagggggctatcatggctgttgga
gcatcaaagccgaccgttgtcactgatgctgatggctttttcagcgtgaaaagtaaaatg
ttggtgaatgtgactgctgatcaccgaatagtttatggtgctgacttggctgccttcctt
cagaccttcgcaaagatagttgagaatccagaaagcctgaccttgtag

DBGET integrated database retrieval system