KEGG   Cucurbita maxima (winter squash): 111479670Help
Entry
111479670         CDS       T05246                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111479670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmax03036]
    111479670
Enzymes [BR:cmax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111479670
Chromosome and associated proteins [BR:cmax03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111479670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 111479670
NCBI-ProteinID: XP_022980242
LinkDB All DBs
Position
Unknown
AA seq 691 aa AA seqDB search
MDSPIPFQDLNLLPDPSAAVIPAATSPKTPTINSSVNKIVERGELLTPKLEPKLEPFDDL
FESRETQQPHQVQQPFLSSPSSNFFSNSDFAPTPLSDQNLTPLSQSSSISSDKDNVYSEF
YRISQLFRSAFGKGIQSYGDAGVVDPDARAIVPVSEENQISTVVVSKRRYDKRSSELVRV
TDLGVEDQRYFRDVVRRTRMIFDSLRVLSTSEEEKSSGLIRRLRGDLRASSLMRERGLWL
NRDKRIVGSIPGVHIGDLFFFRMELCVVGLHGQAQAGIDYVPASQSSNGEPIATSIIVSG
GYEDDEDAGDMIIYTGHGGQDKFSKQCMHQKLEGGNLALERSMHYGIEVRVIRGIKYSGI
VTSKIYVYDGLYRILDCWFDVGKSGFGVYKYKLLRIDGQAEMGSSIVKFAENLRTRPLSL
RPSGYLSLDISLKKEAVPVLLFNDIDNDQEPLYYEYLVRTVFPPFAFHQSGSGTGCNCVS
GCVHDCFCAMKNGGEFGYDQNGFLVRGKPIIFECGPFCQCPPQCRNRVSQKGLRHRLEVF
RSRETGWGVRSLDLIHAGSFICEYAGVVLTREQAQVLSMNGDTLIYPNRFSDRWAEWGDL
SQIYSNYMRPSYPSVPPLDFAMDVSRMRNVACYISHSTSPNVLVQFVLYDHNNLMFPHLM
LFAMENIPPLRELSIDYGVADEWSGKLAICN
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggattctcctatcccatttcaagacctcaatcttcttcccgacccatccgctgctgta
ataccggctgcaacttctcccaaaacacccacaatcaactcttctgttaacaaaattgtt
gaacgcggcgagctgctgacccccaagcttgaacctaagctcgagcccttcgacgatctt
ttcgagtcccgggagacccaacagccccatcaagttcagcaacccttcttgtccagccct
tcctctaacttcttctctaactctgacttcgctcctacccccttgtccgaccaaaatctt
acccctctttctcagtcttcgtccatttcctctgataaggacaatgtttactccgaattt
taccgcatttctcagctgtttaggtctgcttttggcaaaggaattcagagctatggcgat
gcaggagttgtggatcctgatgctcgggcaattgtcccagtttcggaggagaatcagatt
tctactgtggtggtctctaagaggaggtatgataaaaggtcctctgaactcgttagagtc
actgatcttggggttgaggaccagaggtacttccgagacgtggtgagacggaccaggatg
attttcgattcgttgcgtgtgttatcaacgtcggaggaggagaagagttcgggactaatc
cggcgacttcggggtgatttgagggcttcgtccttgatgagagagcgtggtctgtggttg
aatcgagacaaacggattgttggttcgattccgggggtgcacattggcgatctattcttc
tttaggatggaattgtgtgttgttggattgcatggtcaggctcaagctggaattgactat
gttcctgcgagccagagctccaatggcgagccaattgccactagcataattgtttctggg
ggttacgaggacgatgaggatgcgggggatatgattatctacacgggtcatggtgggcaa
gacaaattttcaaaacaatgtatgcaccagaaactcgaaggtgggaatcttgcactggag
agaagcatgcactacgggattgaagtgagggttattcgaggtatcaagtactcgggcatt
gtaacaagtaagatttatgtatacgatggtctgtatagaattcttgattgttggtttgat
gtggggaagtcgggttttggtgtctataaatataagctgttgagaattgatggtcaagcc
gaaatgggtagctccattgtcaagttcgcggagaatctcaggactagaccattgtctttg
agaccttctggttatctcagtctggacatttcactgaagaaggaggcagttccagttctc
ctgttcaatgatattgacaacgatcaagaaccactgtattatgagtatcttgttagaact
gtgtttccacctttcgcctttcaccagtcaggaagtggcactgggtgtaattgcgtttca
ggttgtgttcacgattgcttttgtgctatgaaaaatggtggggagtttggttatgatcaa
aatggatttctagtgagaggaaagcctataatttttgaatgcggaccattctgtcaatgc
ccccctcaatgtcggaatcgtgtttcacagaagggcttgaggcaccgactcgaggttttt
aggtccagggaaacaggttggggagttagatctttggacttgatacatgctggttctttt
atatgtgaatatgcaggagttgtcctcacgagggaacaagctcaagttctttctatgaat
ggtgatacattgatatatccaaatcgtttttcggatagatgggcagaatggggtgatcta
tctcaaatatattctaattatatgcggccatcttacccttccgttcctcctctcgatttt
gcgatggatgtatccagaatgaggaatgttgcttgttatataagccatagtacatctcca
aacgtgttggtgcagttcgtattatatgatcataataacttaatgtttcctcatcttatg
ttgtttgcgatggaaaacatccctcctctgagagagcttagcattgattatggtgtggct
gatgaatggtcagggaaacttgctatctgtaactaa

DBGET integrated database retrieval system