KEGG   Cucurbita maxima (winter squash): 111481863Help
Entry
111481863         CDS       T05246                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00020  Citrate cycle (TCA cycle)
cmax00190  Oxidative phosphorylation
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
cmax01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111481863
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111481863
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111481863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 111481863
NCBI-ProteinID: XP_022983213
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MASGILRRAIARVSATPPSRFVRIRAHAAAAEAQQVEQKAAASTNLKTFAIYRWNPDSPS
KPELQEYKIDLKECGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGCNGLACL
TKIPSGASSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSEPPVPGKEILQSKKD
RAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAIND
EFKLYRCHTILNCARACPKGLNPGKQIQNIKQLQLVG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggaatcctgaggagggcaatagctagggtttctgcaactccaccttcaaga
ttcgttcgaattcgagcacatgctgcggctgccgaagcgcagcaagttgagcagaaagcg
gccgcctcaacgaacctaaagacattcgcaatctaccgatggaaccctgatagtccttct
aaaccagagcttcaggagtacaagatcgatctcaaagagtgcggccccatggtgctagat
gcgcttatcaaaatcaagaacgaggtcgaccctactctaaccttccgccgttcgtgccga
gaggggatctgcggctcctgtgcgatgaacatcgatggatgtaatggattggcttgcttg
accaagattccgtccggagcttcctcgacgattacgccgctgcctcatatgttcgtgatc
aaggatctggtggtggacatgaccaatttctataaccagtataagagtattgagccgtgg
ttgaaaaggaagagcgagccgcctgtgcctgggaaggagatacttcagagtaagaaagat
agggctaagttggatggaatgtatgagtgtatattgtgtgcttgctgtagtacatcgtgc
cccagctattggtggaacccagagtcctacctcggaccagccgctttgctccatgccaat
aggtggataagcgatagccgtgatgaatataccaaagaaagacttgaggcaataaatgat
gaattcaagctctatcgttgtcatactattctgaactgtgcccgtgcatgtcccaagggt
ttgaaccctggaaaacagattcaaaatatcaaacaacttcagcttgtgggttga

DBGET integrated database retrieval system