KEGG   Cucurbita maxima (winter squash): 111483595Help
Entry
111483595         CDS       T05246                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax03030  DNA replication
cmax03410  Base excision repair
cmax03420  Nucleotide excision repair
cmax03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111483595
   03410 Base excision repair
    111483595
   03420 Nucleotide excision repair
    111483595
   03430 Mismatch repair
    111483595
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cmax03032]
    111483595
   03400 DNA repair and recombination proteins [BR:cmax03400]
    111483595
Enzymes [BR:cmax01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111483595
    6.5.1.6  DNA ligase (ATP or NAD+)
     111483595
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111483595
DNA replication proteins [BR:cmax03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111483595
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111483595
DNA repair and recombination proteins [BR:cmax03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111483595
   NER (nucleotide excision repair)
    Other NER factors
     111483595
   MMR (mismatch excision repair)
    Other MMR factors
     111483595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 111483595
NCBI-ProteinID: XP_022985559
LinkDB All DBs
Position
Unknown
AA seq 804 aa AA seqDB search
MLSLRSCYCLRPITLAHPQFKKLIFSNKPPSFKPIFQNFVSAMSSRPSAFDALMSGARAA
AKKKPVNSSPKKRKALDSLDPPPKPNSSLALDSTPPVESQCVSSTSTLDNHGDPNLVKSE
EAVDLGETKLRQDDGGKFGGKIGPVANKKCASSVQERTAKLKSSIPELKKKAKDFNSKQF
ACWNEGERVPFLFLCLGFDMISEESSRITITDIVCNMLRTVMDTTPDDLVATVYLLANKI
APAHEGLELGIGDASIIKALSEAFGRTEAQVKKQYKELGDLGLVAKASRSSQSMMRKPDA
LTITKVFDSFRLIAKESGKDSQEKKKNHIKSLLVAATDCEPLYLIRLLQTKLRIGLAEQT
LLAALGQAAVYAEKHSTPPANVQSPLEEGAKIVKQVYSVLPVYDKLVPALLNGGVWNLSK
TCNFTPGIPIGPMLAKPTKGVSEILNKFQGLEFTCEYKYDGERAQIHYMEDGSVEIYSRN
AERNTGKFPDVVLTVSRIKKPSVRSFILDCELVAYDRGKQKILPFQILSTRARKNVAVSD
IKVEVCVFAFDLLYLDGQPLIQKELSVRREHLYDSFIEEAGYFQFATAITTSDLEEIQKF
LDASVDQSCEGLIIKTLNRDATYEPSKRSLNWLKLKKDYIDNIGDSLDLVPIAAFHGRGK
RTGVYGAFLLACYDNDNEEFQSICKIGTGFSEAMLEERSASLRSKVIPEPKSYYRYGDTI
NPDVWFEPTEVWEVKAADLTISPVHRAGVGIVDSNKGISLRFPRLVRVRKDKTPEEATLS
EQVADMYNAQKLNHQNNQDDNDED
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgctttctctgcgttcatgctactgtttacgccccattacattggctcatcctcaattc
aagaaactcatcttctccaacaaacctccctctttcaaacccatttttcagaattttgtt
tcagcaatgtcttctcgtccttctgctttcgatgctctcatgtccggtgctcgggccgct
gccaagaagaagcctgtaaattcttctcctaagaagcgtaaagccctagattctttagac
cctcctccgaaacctaactcttccctggctctggactcaacgccgcctgttgaatcgcag
tgcgttagttcaacctcaactttggataatcacggagatcctaatctggttaagtccgag
gaagctgtagatttgggggaaaccaagttgcgtcaggatgatggtgggaagtttggaggc
aagattgggccggttgcgaataagaagtgcgcgtctagtgttcaagaaagaactgcgaaa
ttgaagagctctatcccagagttgaaaaagaaggccaaggatttcaactcgaaacaattt
gcatgttggaatgagggcgaacgggttccatttttgtttctgtgtttggggttcgatatg
atttcggaggagtctagtaggattactatcaccgatatcgtctgcaacatgctgaggacc
gtcatggatactacacccgacgacttggtagccaccgtgtatcttttggcgaataagatt
gctcccgcgcacgaagggctcgagttggggattggggatgcttctattatcaaagctctt
tctgaggcatttgggaggacagaggcacaggttaaaaaacagtacaaggaattgggagat
ttaggtcttgttgccaaagcaagccgttcgtcacaatccatgatgcgaaagcccgatgct
ttaactattaccaaagtatttgactcatttcggctgattgctaaggaatctggcaaggat
agtcaggagaagaaaaagaaccatatcaagtcactgcttgttgctgccactgactgcgaa
cctttgtatctgattagattgctgcagacaaaattgcgaattggacttgctgagcagact
cttttagctgcattagggcaagcagctgtatatgctgaaaaacattcaacgcccccagcg
aacgttcaatctcctctagaagagggtgctaagattgtaaagcaggtgtattctgtgctc
cctgtttatgataaactggtccctgcgcttcttaatggtggtgtgtggaacctttcaaaa
acatgcaactttacaccgggaattccaattggacctatgttggcaaaaccaacgaaggga
gtctccgagatcttaaataaattccagggtttggaatttacttgtgaatacaaatatgat
ggggaacgtgcccagattcattacatggaagatggttcagttgagatctacagtcgaaat
gctgaacggaacactggaaagttccctgatgttgttctcacggtatcaaggataaagaaa
ccatctgtaagatcgtttattttggattgtgaacttgttgcttatgatcgtggaaagcag
aagattttgccttttcagattctgagtacacgagctcgcaaaaacgtggccgtgagcgat
attaaggttgaagtgtgtgtatttgcttttgatttactgtaccttgatggtcaaccactt
attcagaaagaacttagtgttcgtcgagagcatctctatgattcatttattgaagaagct
ggatattttcaatttgccacagcaataacaacaagcgaccttgaggaaatacaaaaattc
cttgatgcatctgttgatcaaagttgtgagggtttaatcatcaaaacattgaaccgggat
gctacttacgagccttccaagaggtcacttaactggctaaaactgaagaaggattacata
gacaacataggtgattcacttgatctggtaccaattgctgctttccatggccgtgggaag
cgtacaggtgtctatggcgcatttctccttgcctgttatgacaatgacaatgaagaattt
caaagcatttgtaagattggaactggtttttctgaagcaatgcttgaggaacgttctgct
agtctccgttctaaagtcattccagaaccaaagtcatattatcggtatggagatacaatc
aatccagatgtttggtttgaacctaccgaggtttgggaggttaaagcggcagacttgact
atcagcccagttcatcgtgcaggagtcggcatcgtggattccaacaagggaatttctctt
cggtttccacgtcttgttcgtgtaaggaaagacaaaactccagaggaggccacattgtct
gagcaggttgccgacatgtataatgctcagaaactcaaccaccaaaacaatcaagatgac
aatgatgaagactga

DBGET integrated database retrieval system