KEGG   Cucurbita maxima (winter squash): 111483793Help
Entry
111483793         CDS       T05246                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111483793
Enzymes [BR:cmax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111483793
Chromosome and associated proteins [BR:cmax03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111483793
   Polycomb group proteins
    PRC2-EZH2 complex
     111483793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 111483793
NCBI-ProteinID: XP_022985876
LinkDB All DBs
Position
Unknown
AA seq 923 aa AA seqDB search
MASKASLPSSSVDRSDLHDDTQITKSQEQDPIPKEILSVIDFLKKQVAGERCNSVQKRME
ENKQKLVGITTHLLKSSTERRIRRASDSDKGVDLLTKRQKDALDMQNGINVSDGENDRSQ
EDGHEPSAVLLGSNVAVRNAVRPIKLPEAKTLPPYTTWIFLDRNQRMTEDQSVVGRRRIY
YDQSGGEALICSDSEEEVIEDEEEKRDFVESEDYILRMTIKEIGSSDLVLESLASCFSRS
PGEIQVRYEVLTQGEKAVGCFNNRINEEISHIASTFLDKDLDAALDSFDNLFCRRCLVFD
CRLHGCSQDLVFPAEKQPKWGPVGEENVPCGPLCYRSVLKSDKNYTGGSPLRSDLEEKHP
MSSDGTGAQISKKKKSSRKAARRRAKSYQSESASSNAKNISESSESENELRQDGNTIHQS
PPPNSKITGVGGIPKRNSKRVAERVLICMQKKQKKMAASESESLASVGHCPNDVKIKSNS
YKENDDTSSSSRKNIRSPTVGRPRRESLTQQYNKFEQNETLNNSSNEIITHLPIDSCDDN
SRIEECVDENLCKQDLAEDKSWKAIEKGLYEKGIEIFGRNSCLIARNLLNGMKTCWEIFQ
HMNYSENKNCSQVGDGSNPHLDGYAKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIR
KRITERKDQPCRQYNPCSCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQC
RSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGR
SDISGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAY
RKGDKLKFANHSPVPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR
KPEASGSKKDDGAPSSGRAKKLA
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttctttgccttcgtcttccgtcgacaggtcggatctgcacgatgac
acccagataacgaaatcacaagaacaagatcctattcctaaggagatattatcagtcatt
gattttctaaagaagcaagttgctggtgaacgctgtaactccgtacagaaaagaatggaa
gaaaacaagcagaaattggttggcatcaccactcacttgttgaaatcatcaacagaaaga
aggataagaagggcaagtgattcagataagggggtggatctattgacgaagaggcagaaa
gatgcacttgatatgcagaatggtatcaatgtaagtgatggggaaaatgaccgatctcaa
gaagatggccatgaaccttctgcagttcttcttggatctaatgttgcagttagaaatgct
gttcgacctattaagcttcctgaagctaaaacattgcctccttatactacatggatattt
ttggacagaaatcagagaatgactgaagatcaatctgtggttggtcgaagaagaatttat
tatgatcaaagtggaggagaagccctcatttgcagtgacagtgaggaagaagtaatcgag
gatgaagaggaaaagagagattttgtggaatctgaagattatatacttcgcatgaccatt
aaagaaattggttcatctgatctggtgctagaatcacttgcaagttgtttctctagaagt
cctggtgaaatacaggtaagatatgaagtgcttacgcagggagaaaaggctgtagggtgt
tttaataataggatcaatgaggagatctcacatattgcaagtacttttcttgataaagat
ctagatgcagctcttgattcctttgacaatctattttgccgccgctgccttgtctttgat
tgtcgattacatggttgttcccaagatcttgtctttcctgctgagaaacaacctaaatgg
ggtcccgtaggtgaggaaaatgtaccctgtggtccactctgctatcgatcagtactgaaa
tcagacaaaaattatacagggggctctccacttcgcagtgacttggaagaaaaacatccc
atgtcatctgatggtactggtgctcaaatctccaaaaaaaagaaatcttctcgtaaagct
gctcgaagaagggcaaaatcctatcaaagtgaaagtgcctcatcaaatgcaaagaacata
tcagaaagcagtgagtcagagaatgaactcaggcaggatgggaatactattcatcaatcg
ccaccaccaaattcaaagataacaggagtgggtggaattccaaaaaggaacagcaagcgt
gttgctgagcgtgttctcatttgcatgcagaagaagcagaagaaaatggctgcttctgag
tcagaatctcttgccagtgttggccattgtccaaatgatgtgaaaataaaatctaattca
tataaagaaaatgatgatactagttcttcatcacgtaagaatattagatctcctactgtg
ggaaggcctaggagggaatccctgactcagcaatacaacaaatttgagcagaatgaaaca
ctcaataattcatcaaatgagataattactcatctaccgatcgacagttgtgatgataac
tcaaggattgaagagtgtgtggatgaaaatttatgcaagcaggacttggcagaggataaa
tcttggaaagctattgaaaaaggtctctatgagaagggcattgagatttttggtaggaac
agctgcttaatagctaggaatttactgaatgggatgaaaacctgttgggaaatttttcaa
cacatgaattattctgaaaacaagaattgtagccaagtgggtgatgggtcaaatcctcat
cttgatggttatgccaagggtaataatgaggtgagaagaaggtcaagatttttacgtaga
aggggtagagttcgtcgattgaaatatacctggaaatcagctgcttaccattcaatccgg
aagcgaataactgaaaggaaagatcagccatgcagacagtataatccatgtagttgccaa
actgcctgtggaaagcagtgtgcctgtcttttaaatggcacctgttgtgagaagtactgt
gggtgccctaagagttgcaagaaccgttttagaggatgtcattgtgccaaaagtcaatgt
cgaagtcgtcagtgtccttgctttgcagcagatagagaatgtgatccagatgtttgtagg
aattgttgggtcagctgtggtgatggtactcttggggttcccaaccaaagaggcgataat
tatgagtgcaggaacatgaagcttcttctgaaacaacaacaaagagtgttacttggaaga
tctgatatatctggttggggagcatttttaaagaatagtgttggcaaacacgaatatctc
ggcgagtatactggggagttaatttctcatagggaggctgataaacggggcaaaatatat
gatcgtgaaaactcgtcgtttctgttcaatttgaatgaccagtttgttcttgatgcgtac
agaaaaggtgataaattaaaatttgccaatcattctccagttccgaactgctatgctaag
gtcatcatggttgcaggagatcaccgggttggcatctttgccaaggaaagaatcagtgct
ggtgaggaactgttctatgattatagatatgagcctgatcgagcccctgcttgggctagg
aagcctgaggcatcagggtcgaaaaaagacgacggtgctccatcgagcggtcgagcaaag
aaacttgcttaa

DBGET integrated database retrieval system