KEGG   Cucurbita maxima (winter squash): 111489330Help
Entry
111489330         CDS       T05246                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00564  Glycerophospholipid metabolism
cmax01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111489330
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     111489330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox Pyr_redox_2 FAD_binding_3 NAD_binding_8 Pyr_redox_3 GIDA Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 111489330
NCBI-ProteinID: XP_022993261
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MATATRLGKIAVAAVATAAGGSILLQPSLASNDRGTSGHALESYRNKINDLTAVVPPRSV
QESALIGASPVNPLDILVVGGGATGCGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYKQLKLVFHALEERKQFIENAPHLCHALPCMTPCFDWFEVIYYWIG
LKMYDLVAGSRLLHLSRYYSAQESVELFPTLARNGQGRSLKGTVVYYDGQMNDSRVNVGL
ACTAAMAGAAVLNYAEVVGFLKDEGSDRIIGATIRDKLSGREFDTYAKVIVNAAGPFCDS
VRKMADKEAVSMICPSSGVHVVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTGITMVPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAIDPSAKNTESISR
DHVVCEDYPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLKPTNECVTNKLRLVGGDGWGP
AYFTVLAQQYLRMKKSHSGKVVPGVMDTAAARHLSLAYGILGEKVAAIAQNENLGKRLAH
GYPFLEAEVAYCARHEYCESAVDFIARRSRLAFLDTDAANHALPRVIEILADEHNWDKKR
QKQELQKAKQFLETFKSSKNAHFHDGKHS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccacagccacacggctgggtaagatcgccgttgccgccgtagccaccgctgccggc
ggatcaatcctgcttcagccttctctcgcctctaatgaccgtggtaccagtggtcacgct
ctcgagtcatacaggaacaagatcaatgatctgacagcagttgttccgccccgatcggtt
caggagtcggctctgatcggtgccagccccgtcaatcctcttgacattctcgttgttggc
ggaggcgccactggatgtggcgtcgcgctcgatgccgttactcgaggacttcgcgtaggc
ctcgtcgagcgcgaggatttctcatccgggacgtcttcgcgctctaccaagctcattcat
ggaggcgtgcggtatttggagaaagcagtgttcaatttggattacaagcagcttaaattg
gtgtttcatgcgcttgaggaacgaaaacagtttattgaaaatgcaccacacctatgccat
gcgttgccctgcatgacaccttgttttgactggttcgaggtcatctactattggattggg
ttgaagatgtacgatttggttgcagggtctcgcctcttgcacttgtctcggtactattct
gcccaggagtccgtggagctcttccctacccttgctaggaatggtcagggcagaagtttg
aaaggcaccgttgtgtattacgatgggcagatgaatgactcgcgagtcaatgtggggctt
gcttgtactgccgcaatggctggtgcggcggtgctgaattatgcagaagttgtgggattt
ttgaaggatgagggcagtgatcgaatcatcggagcgactattcgtgacaagttgtcaggt
agagagtttgatacctatgcaaaggtgattgtcaatgctgctgggccattttgtgactca
gtgagaaagatggccgataaagaggcagtgtctatgatctgtcccagcagtggtgttcat
gtagttctccctgattattattctcccgaaggaatgggtctgattgttcccaagactaag
gatgggcgtgttgtttttatgctgccatggttaggacgaacagttgctggaaccacagat
tccaacactggcatcactatggttcctgagccacacgaggatgaaattcagtttatactg
gatgcaatctctgattaccttaacgtgaaggtgcggcgaacagatgttctctcagcttgg
agtggtattcgccctttagctatagatccatcagctaaaaatacggagagcatctcaaga
gatcatgttgtttgtgaagattatcccggattggtcacaattactggtgggaaatggact
acttatcggagcatggcagaagatgctgttaatgcagctataaagtccggaaagctaaag
ccgacaaatgaatgtgtaactaacaagctgcgacttgttggtggagatggatggggacct
gcatattttactgtcttagctcaacaatatttacgcatgaagaagagtcatagtggtaaa
gttgtccccggagttatggacactgcagctgcaagacatttatctcttgcgtatggcatt
ttaggtgaaaaagtggccgctatagcccagaatgagaatttgggcaagcggttagcccat
ggctaccccttcttggaggctgaggttgcatactgtgctcggcatgagtactgtgaatct
gcagtagatttcatcgccagaagatcacggctcgctttccttgatacagatgctgctaat
cacgcattacctcgagtaatcgagatattagcagatgaacataattgggataagaaaaga
cagaaacaagaactacagaaggccaagcagtttttagaaactttcaagtcttcaaagaat
gctcacttccacgatggaaagcacagttag

DBGET integrated database retrieval system