KEGG   Cucurbita maxima (winter squash): 111491386Help
Entry
111491386         CDS       T05246                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111491386
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111491386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111491386
NCBI-ProteinID: XP_022996071
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MQAVLAAMAAQSLISASPSSYIQVSPFSISSPPPSLISSFHGASLKLPRHSLSLAASVAP
KPFVVVAATKKAVAVLKGTSNVEGVVTLTQEDDGPTTVNVRITGLTEGLHGFHLHEYGDT
TNGCISTGPHFNPNKLTHGAPEDEIRHAGDLGNIVAKADGVAEATIVDNQIPLSGPNSVV
GRAFVVHELEDDLGKGGHELSSTTGNAGGRLACGVVGLTPV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagttctggcagctatggcggcgcaatccctcatctctgcctccccttccagc
tacatccaagtgtcccccttctcaatttcttcccctccgccttccctaatctcctccttc
catggcgcatctctcaagctacctcgccactccctttccctagctgcctccgtcgccccc
aagccttttgttgtcgttgccgctaccaagaaagccgtcgccgttctcaagggtacttcc
aatgtcgaaggcgtcgtcacactgacccaagaagacgatggtccaacaacagtaaatgtt
cgtattactgggctcacggaagggcttcatggattccatcttcatgagtatggagacaca
acaaatggatgcatttctacaggaccacatttcaatcctaataagttaactcatggtgct
cctgaggatgaaatccgtcatgcgggtgacctgggaaacattgttgccaaggctgatgga
gtagcggaggcaaccattgtagataatcagattcctctcagtggccccaactctgtagtt
ggaagagcctttgtggtacatgagcttgaggatgatcttggaaaaggaggtcatgaactc
agttcaaccacaggcaacgctggtggaagattggcatgtggtgtcgtcgggctgacccct
gtgtaa

DBGET integrated database retrieval system