KEGG   Cucurbita maxima (winter squash): 111492798Help
Entry
111492798         CDS       T05246                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00250  Alanine, aspartate and glutamate metabolism
cmax00410  beta-Alanine metabolism
cmax00430  Taurine and hypotaurine metabolism
cmax00650  Butanoate metabolism
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
Module
cmax_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111492798
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111492798
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111492798
   00430 Taurine and hypotaurine metabolism
    111492798
Enzymes [BR:cmax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111492798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 111492798
NCBI-ProteinID: XP_022998022
LinkDB All DBs
Position
Unknown
AA seq 494 aa AA seqDB search
MVLTTVADSGESVNCTFGSRYVRSPPPKFNLGEKSIPKDAAYQIIHDELMLDGIPRLNLA
SFVTTWMEPECDNLIMASLNKNYVDMDEYPVTTELQNRCVNMIARLFHAPIVEDEAAVGV
GTVGSSEAIMLAGLAFKRKWQNKRRSQGKPCHNPNIVTGANVQVCWEKFARYFEVELKEV
KLSEGFYVMDPMKAVELVDENTICVAAILGSTLTGEFEDVKLLNELLSKKNKETGWDTPI
HVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKEDLPDELV
FHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMENCKENARVLKEGIEKM
GRFEVVSKNVGVPLVAFTLKDSTKHTVFEISENLRRFGWIVPAYTMPPDAQHIAVLRVVI
REDFSRSLAERLISDINKVLKEVDALPVRVAVKAAEEEDGERIIKHVKKSDKEIEGEIAA
YWKRLVDGKRTGAC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggttttgacaacagtagcagactccggcgaatctgtgaactgcacttttggttccaga
tatgtccggtctccaccgccgaagttcaatctgggggagaaatcgatacccaaagatgca
gcgtaccagatcatacatgatgagttgatgcttgacgggatacccaggttgaacttggcc
tcctttgttaccacatggatggagcctgaatgtgataacctgatcatggcttctctcaac
aagaactatgtggacatggatgagtaccctgtcaccactgagctccagaatcgatgtgtg
aatatgatagctcgcctgtttcatgcccccattgtagaagatgaggctgctgttggtgta
gggactgtgggatcatcagaggctattatgctggcgggtcttgctttcaagaggaaatgg
cagaacaaaagaagatctcaaggcaagccctgtcataaccccaacatagtcactggagcc
aatgtgcaggtgtgttgggagaagtttgctaggtactttgaggttgagctgaaggaggtg
aagctttctgaagggttttatgttatggatcctatgaaggctgttgaacttgtggatgag
aacaccatttgtgttgcagccattttgggatccactttgacaggagagtttgaggatgta
aaactccttaatgaactgctctctaagaagaataaggaaacaggttgggataccccaatt
catgtcgatgcagccagtggtgggtttatagctccgttcctttatcccgatctcgagtgg
gattttcggttgcctttagtgaagagtatcaatgttagtggccataagtatgggcttgtt
tatcctggtgttggatgggttgtttggaggagtaaagaggatcttcctgatgagcttgtg
ttccatattaactatcttggttctgatcaacccaccttcactcttaacttctctaaaggt
tctagccaaatcattgctcagtattatcagttcatacggctcggtttcgagggatacaaa
aacgtgatggagaactgcaaggagaatgcaagagtgttgaaagaaggaatagagaagatg
ggaaggtttgaggttgtttccaagaatgttggagtacccctagtagccttcactctcaaa
gacagcaccaagcacaccgtgttcgagatatccgagaacctaaggaggtttggatggatc
gtgccagcttacacgatgccaccagatgctcagcacatcgccgtgctacgtgtcgtgatc
agggaggacttcagccggagtttggcagagagactgatctcggacatcaataaagtcctg
aaggaagtcgatgcgctgccggttcgggtggctgtgaaagcagctgaagaagaagatggt
gagagaattataaagcatgtgaagaagagtgataaggaaattgaaggagaaatagctgca
tattggaagaggcttgtggatggcaagagaactggtgcctgctag

DBGET integrated database retrieval system