KEGG   Cucurbita maxima (winter squash): 111495351Help
Entry
111495351         CDS       T05246                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00052  Galactose metabolism
cmax00500  Starch and sucrose metabolism
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111495351
   00500 Starch and sucrose metabolism
    111495351
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     111495351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 BON
Motif
Other DBs
NCBI-GeneID: 111495351
NCBI-ProteinID: XP_023001112
LinkDB All DBs
Position
Unknown
AA seq 937 aa AA seqDB search
MDSDIFCKEIRRRPHPYISTTMATGSKSLQAFLRRRRLLSAVVLFLFSCFFRLIASLPFA
AGEQRENSAVGYGYRVRSGRVDPTGKSLTADLDLIEKSSVYGPDVERLSLQASFETKDRL
RVRITDSNRERWEIPDEIIPRRSNSRIRSLPERDVGSPETSIISDPASDLIFSLHDTAPF
GFSVHRRSSGDVLFDTSPNFSDSETFLVFKDQYIQLSSSLPKDRSSLFGIGEQTRKSFKI
VPDKSKTLTLWSADIGSVNTDVNLYGAHPFYIDVRSPSRDGKVAAGTTHGVLLLNSNGMD
IIYSGDRISYKAIGGIIDLYFFAGPSPISVIDQYTELIGRPAPVPYWSFGFHQCRYGYKN
VSDIETVVARYAKAGIPLEVMWTDIDYMDGYKDFTFDPINFPVEKMKNFVDSLHQNGQKY
VLIVDPGISTNKTYGTYIRGIEADIFIKYDGVPYLGEVWPGPVYFPDFLHPNSEIFWGGE
IKLFRDIVPFDGLWIDMNELSNFITSSTSPFSNLDNPPYKIDNAGVQRPINNRTVPASSL
HFGNLTEYNTHNLYGFLESKATHASLVKVTGKRPFVLSRSTFVGSGKYTAHWTGDNAATW
NDLGYTIPSILNFGLFGIPMVGADICGFSGDTTEELCRRWIQLGAFYPFARDHSDKGSIR
QELYLWDTVAASARKVLALRYSLLPYIYTLMYEAHKKGTPIARPLFFSFPQDIRTYEINS
QFLLGEGVLVSPVLKEGALSVDAYFPAGNWFSLFNYSESVAVKSGQQITLDAPADHINVH
VREGNILALHGEATTTQAARKTAFKLLVVVSNGQSSSGEVFLDDGEVVEMGEEGGNWSLV
RFYSEAVGSKLLIKSQVINGGFALSQKMIIDKVTFVGFERPKKMGGLGLDISKGANLNGN
SGIRKTYEYSAKFVNVEISGLSIPICEEFVMELSPLN
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggatagtgacattttttgcaaggagataagaagaagacctcacccttacatctcgaca
acaatggcgactggttccaaatctcttcaagcttttctccgtcgccgtcgtttactctcc
gccgtcgtactcttccttttcagttgcttctttcgtctaattgcatctctaccgttcgcc
gccggcgagcagagagaaaactcggccgtcggatatggataccgagttagatcggggcgt
gttgaccctaccggaaagtcgttgaccgccgatcttgacctgatcgaaaaatcctccgtc
tatggacctgacgttgagagacttagcctccaagccagttttgaaaccaaagatcggtta
agagtgcgaataacagactcaaatcgggaacgatgggaaataccggacgagataattccc
cgtcgatcgaactcccgtatccgctcgctgccggaaagagacgtcggctcaccggaaacc
tctatcatctccgatccggcttccgatctcattttcagcctccacgacaccgcaccgttc
ggcttttccgtgcaccggcgatcatctggcgatgtcctcttcgacacatcgcctaatttc
tccgattcggagacttttcttgtcttcaaggaccaatacattcaactatcctcttcgctt
cccaaggacagatcgtctttgtttggcattggcgagcaaaccaggaagtcgttcaagatc
gtgccggataaaagtaaaactttgacgctttggagcgccgatatcggtagtgttaatact
gacgtgaacctctacggtgctcatcccttctacattgacgtccggtcgccgtctcgcgat
ggtaaagttgcggcagggacgacgcatggagttctgttactgaacagtaatggtatggat
attatatactctggagataggattagttacaaggctattggtggaatcattgatttatac
ttctttgcgggtccgtcaccgatatcagtgatagatcagtatacggagcttattgggcgg
cctgcacccgtgccttattggtcgtttggttttcaccaatgtcgttatggctacaagaat
gtttctgatattgagactgtagttgctcgttatgccaaggccggcatacctcttgaagtt
atgtggacagacattgattacatggatgggtataaggacttcacttttgatcccatcaat
tttcccgtggagaaaatgaagaactttgttgatagtcttcatcaaaatggacaaaaatat
gtgctcatcgtggatcccggtattagtacaaacaagacctatggaacatacatccgaggg
attgaagctgatatctttataaaatatgacggggttccatacttgggtgaggtttggcct
ggacctgtttacttccctgattttcttcatccaaacagtgagattttttggggtggtgag
attaaattatttcgagatattgttccatttgatggtctttggattgatatgaatgagcta
tcaaattttataacttcttcaaccagcccattttctaatcttgataaccctccttacaag
attgacaatgctggagtccaacgtccaattaacaataggactgtgccagcatcaagtctt
cattttggtaacttgacagagtataatactcataacttatatggtttcttggagtcaaag
gctactcatgcctcattagtaaaagtaacgggcaaaagaccatttgttctgtcaagatca
acttttgtaggctctgggaagtacacagcacattggactggagataatgctgcgacttgg
aatgatttaggttacacaattccatccattttgaactttggactctttggaattccaatg
gttggtgctgacatatgtggattttctggagatacgacggaagagctgtgccgacgttgg
attcagttaggggcattttacccatttgctagagatcattctgacaaaggatccattcgt
caagagctttatctttgggatacggttgctgcatcagccaggaaggtgcttgcacttcgc
tatagcttacttccttacatctacactttgatgtatgaggcacacaaaaaggggacacca
attgcacgccctcttttcttctcattccctcaggatatcaggacctatgaaatcaactcc
cagtttctacttggagaaggtgtattggtttctccagttcttaaggagggagctctttct
gttgatgcatattttcctgcaggaaactggtttagcctctttaactattctgagtcagtg
gctgtaaagtcagggcagcaaatcactctagacgcacctgctgatcatataaacgtgcac
gtcagggaaggaaacatattggcgttgcacggagaggcgacgacgacacaagcagctcga
aagacggcattcaagcttttggtagtcgtcagcaatggccagagcagctctggagaggtg
ttcttggatgatggagaagtggtggaaatgggagaagagggaggtaattggagtctggta
agattttacagtgaagcagttgggagtaagttactgatcaaatctcaggttataaatgga
ggatttgctttgagccagaagatgatcattgacaaggtgacctttgtaggttttgaaagg
cctaagaagatgggtggccttggtttagatataagcaagggcgcaaacttgaatggtaat
tcaggcatcagaaaaacgtatgagtactctgccaagtttgttaatgtcgagatctcgggc
ttgtccattcctatatgtgaggaattcgtaatggagttgtcaccattaaattag

DBGET integrated database retrieval system