Cucurbita maxima (winter squash): CYL43_pgp079 Help Entry CYL43_pgp079      CDS       T05246                                  Symbol atpH Name (RefSeq) ATP synthase CF0 C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism cmax  Cucurbita maxima (winter squash) Pathway cmax00190   Oxidative phosphorylation cmax00195   Photosynthesis cmax01100   Metabolic pathways Module cmax_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cmax00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CYL43_pgp079 (atpH)    00195 Photosynthesis     CYL43_pgp079 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cmax00194]     CYL43_pgp079 (atpH) Photosynthesis proteins [BR:cmax00194]  Photosystem and electron transport system   F-type ATPase [OT]    CYL43_pgp079 (atpH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  YP_009447437 LinkDB All DBs AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctggattggccgtcgggcttgct tctattggacctggggttggtcaaggtactgctgcgggccaagctgtagaagggatcgcg agacaacccgaggcggagggaaaaatccgaggtactttattgcttagtctggcttttatg gaagctttaacaatttatggactggttgtagcattagcacttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system