KEGG   Caulobacter mirabilis: CSW64_01525Help
Entry
CSW64_01525       CDS       T05166                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00071  Fatty acid degradation
cmb00280  Valine, leucine and isoleucine degradation
cmb00281  Geraniol degradation
cmb00310  Lysine degradation
cmb00362  Benzoate degradation
cmb00380  Tryptophan metabolism
cmb00410  beta-Alanine metabolism
cmb00640  Propanoate metabolism
cmb00650  Butanoate metabolism
cmb00903  Limonene and pinene degradation
cmb00930  Caprolactam degradation
cmb01100  Metabolic pathways
cmb01110  Biosynthesis of secondary metabolites
cmb01120  Microbial metabolism in diverse environments
cmb01130  Biosynthesis of antibiotics
cmb01200  Carbon metabolism
cmb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSW64_01525
   00650 Butanoate metabolism
    CSW64_01525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSW64_01525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSW64_01525
   00310 Lysine degradation
    CSW64_01525
   00380 Tryptophan metabolism
    CSW64_01525
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSW64_01525
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CSW64_01525
   00281 Geraniol degradation
    CSW64_01525
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSW64_01525
   00930 Caprolactam degradation
    CSW64_01525
Enzymes [BR:cmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CSW64_01525
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CSW64_01525
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CSW64_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 UDPG_MGDP_dh_N DAO NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ATQ41182
UniProt: A0A2D2AT42
LinkDB All DBs
Position
311643..313847
Genome map
AA seq 734 aa AA seqDB search
MENFKIEVDGDGIALVTFDVPGRSMNTLTGKVIAEIGEVVERIKTDPEIKGAVIASGKAS
GFCAGADLGELGGQAGAAGEDKRSEQEKLQAAFDGGFALNKAFRALETCGKPVATALEGL
ALGGGLEFALATHYRVAAANPKLQLGLPEAKVGLLPGAGGTQRLPRLMGAMKAAPYLLEG
KSMSAEEAKANGVVGEVVEPGKTIEAAKAWVKTGDPVAPWDKKDYRIPGGGPYTPTGGQV
FIMGNAMLRKQSYGNYPAQLNILKCVYEGLQVPIDAALRIETRYFLKTMQSPQARGMIRT
LFLSLQELGKGASRPAGYPTYDVKKVAVLGAGMMGAGVAYVQAQAGIETVLVDVSAEAAE
KGKGYARTLVEKAVKRGKMTAEKGEALLALIHPTADYADVKGSDLVVEAVFESRELKAKV
TQQAEAQLADTAVMGSNTSTLPITGLAEASVRPANFIGIHFFSPVDKMGLVEIIMGKETS
EETLAKSIDYVLKIRKTPIVVNDSRGFYTSRCFGTFVQEGLQMLAEGIAPAIIDNVGRAT
GMPRGPLEMNDDVALDLAYKIGQQTKADMGEQYVAGPVDALLEKMVVDLKRYGRKNGKGF
YDYPETGQKTLWPGISDLVEITTKDADKALIEEIRTRLLYRQAVEAARCFEEGVITEARD
ADVGAILGWGFAPWTGGPISLIDGVGVKAFVEKLDELTAKYGSRYAPPKLLREMAANGET
FYGRFGPKAAKAAA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttcaagatcgaggtcgacggcgacggcatcgccctggtgaccttcgacgtc
cccggccgcagcatgaacaccctgaccggcaaggtcatcgccgagatcggcgaggtggtc
gagcgcatcaagaccgacccggagatcaagggcgcggtcatcgcctcgggcaaggccagc
ggcttctgcgcgggcgccgacctcggcgagctcggcggccaggccggcgcggcgggcgag
gacaagcgttctgagcaggagaagctgcaggcggccttcgacggcggcttcgcgctgaac
aaggcgttccgcgccctggaaacctgcggcaagccggtggcgaccgcgctggagggcctg
gccctcggcggcggcctggagttcgccctggcgacccactaccgcgtcgcggcggccaat
ccgaagcttcagctcggcctgccggaagccaaggtcggcctgctgccgggcgccggcggc
acccagcgcctgccgcgcctgatgggcgccatgaaggccgcgccgtacctgctggaaggc
aagtcgatgtccgccgaggaggccaaggccaacggcgtcgtcggcgaggtcgtcgagccg
ggcaagaccatcgaggccgccaaggcctgggtgaagaccggcgacccggtcgcgccctgg
gacaagaaggactaccgcatccccggcggcggcccctacaccccgacgggcggccaggtg
ttcatcatgggcaacgccatgctgcgcaagcagtcctacggcaactacccggcccagctg
aacatcctgaagtgcgtctacgaaggcctgcaggtgccgatcgacgccgctctgcgcatc
gagacccgctacttcctgaagaccatgcagtcgccccaggcgcgcggcatgatccgcacc
ctgttcctgtcgcttcaggagctgggcaagggcgcctcgcgtccggccggctatccgacc
tacgacgtcaagaaggtggccgtcctcggcgccggcatgatgggcgcgggcgtggcctat
gttcaggcccaggccgggatcgagaccgtgctggtcgacgtctcggctgaggccgccgag
aagggcaagggctacgcccgcaccctggtcgagaaggccgtgaagcgcggcaagatgacg
gccgagaagggcgaggcgttgctggccctcatccacccgaccgctgactacgccgacgtg
aagggctcggatctggtcgtcgaggccgtgttcgaaagccgtgagctgaaggccaaggtg
acgcagcaggcggaagcccagctggccgacaccgcggtgatgggctccaacacctcgacc
ctgccgatcaccggcctggccgaggcctcggtccgtccggccaacttcatcggcatccac
ttcttctcgccggtcgacaagatgggcctggtcgagatcatcatgggcaaggagacctcg
gaagagaccctggccaagtcgatcgactacgtcctgaagatccgcaagacgccgatcgtc
gtgaacgacagccgcggcttctacacctcgcgctgcttcggcaccttcgtccaggaaggc
ctgcagatgctggcggagggcatcgctccggccatcatcgacaacgtcggccgcgccacg
ggcatgccccgcgggccgctggagatgaacgacgacgtcgccctcgacctcgcctacaag
atcggccagcagaccaaggccgatatgggcgaacagtacgtcgccggcccggtggacgcc
ctgctggagaagatggtcgtcgacctgaagcgctacggccgcaagaacggcaagggcttc
tacgactatccggagaccggccagaagaccctgtggccgggcatctcggacctggtcgag
atcaccaccaaggacgcggacaaggcgctgatcgaggagatccgcacccgcctgctgtat
cgccaggccgtcgaggccgcgcgctgcttcgaggaaggcgtgatcaccgaagcccgcgac
gcggacgtcggcgccatcctgggctggggtttcgcgccctggaccggcggcccgatcagc
ctgatcgacggcgtcggcgtgaaggccttcgtcgaaaagctggacgagctgaccgctaag
tacggctcgcgctacgccccgccgaagctgcttcgcgagatggcggcgaacggcgaaacc
ttctacggccgcttcggcccgaaggcggcgaaggccgcggcgtag

DBGET integrated database retrieval system