KEGG   Caulobacter mirabilis: CSW64_01790Help
Entry
CSW64_01790       CDS       T05166                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cmb  Caulobacter mirabilis
Brite
Enzymes [BR:cmb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CSW64_01790
Peptidases [BR:cmb01002]
 Metallo Peptidases
  Family M2
   CSW64_01790
Exosome [BR:cmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CSW64_01790
CD molecules [BR:cmb04090]
 Proteins
  CSW64_01790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ATQ41229
UniProt: A0A2D2ATA4
LinkDB All DBs
Position
362591..364402
Genome map
AA seq 603 aa AA seqDB search
MLKTKLLAAGAALAIVAGLPAAALAQAPKPTPAEAKAFADKAEADLARLSQYVQKAAWVR
ATYITEDTQWLEAKATSEITDLATKLAIEAAKYDGVAADPVTRRKLDILKRSLVAPAPQR
PGAADEMATIASRLDSTYSTGKFAYKGKQITLNDAEDVMASSRDPAELKAVWEGWHSISP
GMRADYAKLADMSNEGSRQLGYKDTGALWRSGYDMDPDAFAAETDRLWKQIEPFYKNLHC
YVRARLNEKYGDAVQKRTGPIRADLLGNMWAQQWGNIYPLVAPKDEKTSYSLDTLLVNAG
YDPTKMVKTGENFYVSLGLDPLPDTFWTRSQIVRPEGREVVCHASAWDVDDRDDIRIKMC
TKVNGEDFYTIHHELGHNYYQRAYKDQPYLFKNGANDGFHEAIGDFVGLSALTPTYLNQI
GLLKDVPGAEGDIPFLLEMALNKIAFMPFGLLVDRWRWEVFDGELKPEQYNDGWWKLRTQ
YQGIVPPGPRPADAFDPGAKYHVPGNVPYTRYFLAHVYQFQFHRAACQQAGWKGPLHRCS
IYGDKAVGAKFNAMMEMGASKPWPEELKAFTGETRTDASAVADYFQPLNVWLTKQNKGEK
CGW
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaccaaactgctggccgccggcgcggcgctggccatcgtcgcgggcctgccc
gcggccgcgctggcccaggcgcccaagccgaccccggcggaggccaaggctttcgccgac
aaggccgaggcggatctcgccaggctgtcccagtacgtccagaaggccgcctgggtccgc
gccacctacatcaccgaagacacccagtggctcgaggccaaggccaccagcgagatcacc
gacctggcgaccaagctggccatcgaagccgccaagtacgacggcgtcgccgccgacccg
gtcacccgccgcaagctggacatcctgaagcgttcgctggtcgcgccggcgccgcagcgc
ccgggcgccgccgacgagatggcgaccatcgcctcgcgcctggactcgacctattcgacc
ggcaagttcgcctacaagggcaagcagatcaccctgaacgacgccgaggacgtcatggcc
tccagccgcgaccccgccgagctgaaggcggtctgggagggctggcactcgatctcgccg
ggaatgcgcgccgactacgccaagctcgccgacatgtcgaacgaaggctcccgccagctc
ggctacaaggacaccggcgccctgtggcgctcgggctacgacatggatccggacgccttc
gccgccgagaccgatcgcctctggaagcagatcgagcccttctacaagaacctgcactgc
tatgtccgcgcgcgcctgaacgagaagtacggcgacgctgtccagaagcgcaccggcccc
atccgcgccgacctgctgggcaacatgtgggcccagcaatggggcaacatctatccgctg
gtcgcgcccaaggacgagaagacctcctacagcctcgacaccctgctggtgaacgccggc
tacgacccgaccaagatggtcaagaccggtgagaacttctacgtctcgctgggcctcgac
ccgctgccggacaccttctggacccgttcgcagatcgtgcgtccggaagggcgcgaggtg
gtctgccacgcctcggcctgggacgtcgacgaccgcgacgacatccgcatcaagatgtgc
accaaggtcaacggcgaggacttctacaccatccaccacgagctgggtcacaactactac
cagcgcgcctacaaggatcagccctacctgttcaagaacggggcgaacgacggcttccac
gaggcgatcggcgacttcgtcggcctgtcggccctgaccccgacctacctcaaccagatc
ggcctgttgaaggacgtgccgggcgcggagggcgacatccccttcctgctcgagatggcg
ctgaacaagatcgcgttcatgccgttcggcctgctggtcgaccgctggcgctgggaggtg
ttcgacggcgagctgaagccggagcagtacaacgacggctggtggaagctgcgcacccag
tatcagggcatcgtgccgccgggaccgcgtccggccgacgccttcgacccgggcgccaag
taccatgtgccgggcaacgttccgtacacccgctacttcctggcgcacgtctatcagttc
cagttccaccgcgcggcctgccagcaggccggctggaaggggccgctgcaccgctgctcg
atctacggcgacaaggcggtcggcgcgaagttcaacgccatgatggagatgggcgcctcc
aagccctggccggaggagctgaaggccttcaccggcgagacccgcaccgacgcctcggcc
gtggcggactacttccagccgctgaacgtctggctgacgaagcagaacaagggcgagaag
tgcggctggtag

DBGET integrated database retrieval system