KEGG   Caulobacter mirabilis: CSW64_02850Help
Entry
CSW64_02850       CDS       T05166                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00030  Pentose phosphate pathway
cmb01100  Metabolic pathways
cmb01110  Biosynthesis of secondary metabolites
cmb01120  Microbial metabolism in diverse environments
cmb01130  Biosynthesis of antibiotics
cmb01200  Carbon metabolism
cmb01230  Biosynthesis of amino acids
Module
cmb_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
cmb_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CSW64_02850 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CSW64_02850 (tkt)
Enzymes [BR:cmb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CSW64_02850 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ATQ41427
UniProt: A0A2D2ATX9
LinkDB All DBs
Position
575688..577664
Genome map
AA seq 658 aa AA seqDB search
MSVSPVKMADAIRVLSMDAVHHAKSGHQGAPMGLADVATVLWTKFLKYDASKPDWADRDR
FVLSAGHASMLIYSLLHLTGFKAVTMDQIRNFRQWGSATPGHPEYGHTPGVETTTGPLGQ
GIATAVGMAMAERSLHARYGDDLVDHRTWVVAGDGCLMEGVSQEAISLAGRLKLSKLTVL
FDDNNTTIDGEATISETGDQMLRFKAAGWAVKAVDGHDHGKIAAALRWATRQKVPTMIAC
KTKISKGAGPKEGDVHGHGYSLFDEEATLARQAMGWPLPPFELPEDIAAAWLKAGRKGGS
ARRKWDKRLKSHKDGADFTRAVKGDLPTGAFDALQAHIDANIANPVANATRVHSGSALTA
LTPAIPEMIGGSADLTGSNNTYVKGMVPFDAPDYAGRYVHYGVREHGMAAAMNGMALHGG
VIPYSGTFMCFADYSRAAIRLGALMGVRVIHVMTHDSIGLGEDGPTHQPVEHLASLRAMP
NLNVYRPADAIEAAECWQSALQHKTTPSIMALSRQKTPVARTASATENLSAKGAYELAAA
EGGDAQVTIFASGTEVGVALGARQLLQAGGVPTRVVSTPCWELFEQQSAKYRADTIGKAK
VRVAVEAAVKMGWERFIGEDGVFVGMTGFGASAPFERLYKEFGITAEGVAEAAKAKLG
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcagccccgtgaagatggccgacgccatccgtgttctctccatggatgccgtc
catcacgccaagtccggccaccagggcgccccgatgggcctggccgacgtggcgacggtg
ctgtggaccaagtttctgaagtacgacgccagcaagccggactgggccgaccgcgaccgc
ttcgtgctgtccgccggccacgcctcgatgctgatctacagcctgctgcacctgaccggc
ttcaaggccgtcacgatggaccagatccgcaacttccgtcagtggggcagcgccacgccg
ggccatccggaatacggccacaccccgggcgtcgagaccaccaccgggccgctgggccag
ggcatcgccaccgccgtcggcatggccatggccgagcgcagcctgcacgcccgttacggc
gatgacctggtcgaccaccgcacctgggtggtcgccggcgacggctgcctgatggagggc
gtcagccaggaggcgatcagcctggccggccgcctgaagctcagcaagctgacggtgctg
ttcgacgacaacaacaccaccatcgacggcgaggcgaccatctccgagaccggcgaccag
atgctgcgcttcaaggccgcgggctgggccgtgaaggccgtcgacggccacgaccacggc
aagatcgccgcggcgctgcgctgggcgacccgccagaaggtccccaccatgatcgcctgc
aagaccaagatctcgaagggcgccggcccgaaggaaggcgacgtccacggccacggctac
tcgctgttcgacgaggaagcgacgctggctcgccaggccatgggctggccgttgccgccg
ttcgagcttcccgaggatatcgccgccgcctggttgaaggccggccgcaaggggggctcg
gcccgccgcaagtgggacaagcgcctgaagagccacaaggacggcgccgacttcacccgc
gccgtgaagggcgacctgccgaccggcgcctttgacgcgctgcaggcccatatcgacgcc
aacatcgccaacccggtcgccaacgccacccgcgtgcatagcggctcggccctgacggcg
ctgaccccggcgatcccggaaatgatcggcggctcggccgacctgaccggctcgaacaac
acctacgtcaagggcatggtcccgttcgacgcgccggactacgccggccgctacgtccac
tacggcgtgcgcgagcacggcatggccgccgcgatgaacggcatggccctgcacggcggc
gtcattccctacagcggcaccttcatgtgcttcgccgactacagccgcgcggccatccgc
ctgggcgccctgatgggcgtgcgggtgatccatgtgatgacccacgattccatcggcctc
ggcgaagacggcccgacccaccagccggtcgagcacctggcctcgctgcgcgccatgccg
aacctgaacgtctaccgcccggcggacgcgatcgaggcggcggagtgctggcagtcggcg
ctgcagcacaagaccacgccgtcgatcatggccctgtcgcgccagaagacgccggtcgcc
cgcaccgcctcggcgaccgagaacctgtccgccaagggcgcctacgagctggcggcggcc
gagggcggcgacgcccaggtgacgatcttcgcctcgggcaccgaagtcggcgtcgccctc
ggcgcccgccagctgctgcaggccggcggcgtccccacccgcgtggtctcgaccccctgc
tgggagctgttcgagcagcagtcggccaagtaccgcgccgacacgatcggcaaggccaag
gtccgcgtcgcggtcgaggcggcggtcaagatgggctgggaacgcttcatcggcgaggac
ggcgtcttcgtcggcatgaccggcttcggcgcctcggctccgttcgagcgcctctacaag
gagttcggcatcaccgccgagggcgtcgccgaggcggctaaggcgaagctgggctga

DBGET integrated database retrieval system