KEGG   Caulobacter mirabilis: CSW64_08385Help
Entry
CSW64_08385       CDS       T05166                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cmb  Caulobacter mirabilis
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CSW64_08385
Enzymes [BR:cmb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CSW64_08385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 FAD_binding_2 AlaDh_PNT_C Glutaredoxin NAD_binding_7 DAO NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ATQ42429
UniProt: A0A2D2AWP6
LinkDB All DBs
Position
complement(1727895..1729478)
Genome map
AA seq 527 aa AA seqDB search
MLDAALKTQLAAYLQNLRQPIELVATLGDGSSAAEMRALLEDVAAASDKVGVRFDGADDR
APSFAIERAAGDAGVRFAGLPLGHEFTSLVLALLHVGGHPPKIDADVVAQIKALEGRFHF
ETYFSQSCQNCPDVVQALNTMSALNPNITHVAIDGALFKDEVEARQVMAVPTVLLNGEPF
AQGRMTIEQVLSKLDTGAAARAAEKLKDKDPFEVLVIGGGPAGAASAIYAARKGIRTGLA
AERFGGQVLDTMAIENFISVSHTEGPKLAAGLEQHVKDYDVDIMNLQVASRLIPAKAEGG
LIEVQLENGVSLKSRTVILATGARWRQMGVPGENDYRNKGVAYCPHCDGPLFKGKRVAVV
GGGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLASLPNVRIVTSALTTEVRGDG
QKVTGLVYKDRNSDEVHNLDLEGVFVQIGLVPNTEWLKDTVALSPRGEIETDHRGATSVP
GVFAGGDATTTPYKQIVIAMGEGSKAALSAFDYLIRLPAEVTEQAGA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgccctgaagactcagctcgccgcctacctgcagaacctgcgtcagccg
atcgaactggtcgccaccctgggcgacgggtcctcggccgcggagatgcgcgcgctcctg
gaagacgtcgcggccgcgtccgacaaggtcggcgtccgcttcgacggcgccgacgaccgc
gccccgtccttcgccatcgagcgcgccgccggcgacgccggcgtccgcttcgccggcctg
ccgctgggccacgagttcacctcgctggtgctggccctgctgcatgtcggcggccacccg
cccaagatcgacgccgacgtcgtcgcccagatcaaggcgctggagggccgcttccacttc
gagacctatttctcgcaatcctgccagaactgccccgacgtggtgcaggcgctgaacacc
atgagcgccctgaaccccaacatcacccacgtcgccatcgacggcgccctgttcaaggac
gaggtcgaggcgcgccaggtcatggccgtgccgaccgtgctgctgaacggcgagccgttc
gcccagggccgcatgaccatcgagcaggtgctctccaagctcgacaccggcgccgccgcc
cgcgcggccgagaagctgaaggacaaggacccgttcgaggtcctggtcatcggcggcggt
ccggccggcgcggcctcggccatctacgccgcccgcaagggcatccgcaccggcctggcg
gccgagcgcttcggcggccaggtgctcgacaccatggccatcgagaacttcatctccgtc
tcccacaccgagggcccgaagctggccgccggtctggagcagcacgtcaaggactacgac
gtcgacatcatgaacctgcaggtcgccagccgcctgatcccggcgaaggccgagggcggg
ctgatcgaggtgcagctcgagaacggcgtcagcctgaagtcgcggaccgtgatcctggcc
accggcgcccgatggcggcagatgggcgtgcccggcgagaacgactaccgcaacaagggc
gtggcctactgcccccactgcgacggcccgctgttcaagggcaagcgcgtggccgtggtc
ggcggcggcaacagcggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtc
accctgatcgagtacgacagccagctgcgcgccgacgcggtcctgcagcgcaagctggcc
agcctgccgaacgtccgcatcgtcacctcggcgctcacgaccgaggtccgcggcgacggc
cagaaggtcaccggcctggtctacaaggatcgcaacagcgacgaggtccacaacctcgac
ctggaaggcgtgttcgtgcagatcggcctggtgccgaacaccgaatggctgaaggacacg
gtcgccctctccccgcgcggcgagatcgagacggaccaccgcggcgcgacctcggtcccc
ggcgtcttcgccggcggcgacgccacgacgacgccctacaagcagatcgttatcgccatg
ggcgaaggttcgaaggcggcgctgtcggcgttcgattacctgatccgcctgccggccgag
gtgacggaacaggcgggggcttag

DBGET integrated database retrieval system