KEGG   Caulobacter mirabilis: CSW64_15155Help
Entry
CSW64_15155       CDS       T05166                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CSW64_15155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmb02000]
    CSW64_15155
Enzymes [BR:cmb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CSW64_15155
Transporters [BR:cmb02000]
 Other Transporters
  Pores ion channels [TC:1]
   CSW64_15155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ATQ43637
UniProt: A0A2D2B0C4
LinkDB All DBs
Position
complement(3165696..3166301)
Genome map
AA seq 201 aa AA seqDB search
MKLFYLPSACSLSPHIVLREAGLAFELDRIDLATRRTEGGEDYRRINPMGYVPALRLDDG
QVLTEGAAIVQYIADAYPDRNLAPRPGTVERARVQAWLNFIAAELHKAFTPLFRPDVTDE
GRAVAIAEVGRRFDVIEAELSDGRPYLVGGDFGVADAYLFVVARWAIPRGVGLDGWPRLK
ALVERIGERPTVQVALAAEAA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttctacctgcccagcgcctgctcgctgtcgccgcacatcgtgctgcgcgag
gccggcctggccttcgagctggaccgcatcgacctggccacccgtcgcaccgagggcggc
gaggactatcggcggatcaacccgatgggctacgtgccggcgctgcgtctcgacgatggc
caggttctgaccgagggcgcggccatcgtgcagtacatcgccgacgcctatcccgaccgg
aacctggcgccgcgccccgggacggtggagcgggcccgggtccaggcctggctgaacttc
atcgccgccgagctgcacaaggcctttacgcccctgttccggcccgatgtgaccgatgag
ggcagggcggtcgcgatcgccgaggtcgggcggcgtttcgacgtcatcgaggccgagctg
tcggacggccgtccctacctggtcggcggcgacttcggcgtggccgacgcctatctgttc
gtggtggcgcgctgggcgatcccccggggcgtggggctggacggctggccccgcctgaaa
gcgcttgtcgagcggatcggcgaacggccgacggtccaggtggcgctggcggccgaggcg
gcctga

DBGET integrated database retrieval system