KEGG   Caulobacter mirabilis: CSW64_15190Help
Entry
CSW64_15190       CDS       T05166                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00473  D-Alanine metabolism
cmb01100  Metabolic pathways
cmb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CSW64_15190 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CSW64_15190 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cmb01011]
    CSW64_15190 (alr)
Enzymes [BR:cmb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CSW64_15190 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cmb01011]
 Precursor biosynthesis
  Racemase
   CSW64_15190 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Indigoidine_A
Motif
Other DBs
NCBI-ProteinID: ATQ43643
UniProt: A0A2D2B063
LinkDB All DBs
Position
3174127..3175242
Genome map
AA seq 371 aa AA seqDB search
MPCTDDRNSAGRLTVDLDALVRNYRAIAARTAPVPVAAVVKADAYGLGAAPIAAALAAAG
CRHFFVAHLLEARRLKDRLPNDADLFVLNGLTPGAEAEAADLGVIPVLNTLPQVRAWTAL
AAERGGVLPAAIQLDSGMSRLGLAPAELDALLAEPVLLSRLDLRLVMSHLACGDAADGVA
SAEQLAAFLTQADRLPTAPRSLSNSAGSFLDARFHFDLVRPGLALYGAEPHEVPGRALEP
VVSLQARIIQLREVPAGARIGYGYSFEAPRPMRLATIGIGYADGWPRALSNRGAAWRGEA
RLPIVGRVSMDSTILDISALPADALVEGDDVELIGLHQSLDAVAAAAGSITHEILTGLGP
RLHRSYHGTQS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcaccgacgatcgcaacagcgccggccgcctgaccgtcgacctggacgcgctg
gtccggaactaccgcgccatcgccgcccgcacggcccccgttccggtcgcagcggtggtc
aaggccgacgcctatggcctgggggccgcccccatcgccgccgccctggccgccgccggc
tgccgccacttcttcgtcgcccatctgctcgaggcccgacggctgaaggaccgcctgcca
aacgacgcggacctgttcgtgctcaacggcctgacgcccggcgccgaggccgaggccgcc
gatctgggcgtgatcccggtgctcaacaccctgccccaggtccgcgcctggacggcgctg
gccgccgagcgcggcggcgtccttccggcggcgatccagctggacagcggcatgtcgcgc
ctgggccttgcgcccgccgagctcgacgcccttctggccgagcccgtgctgctgtcccgc
ctcgacctgcgcctggtcatgagccacctggcctgcggcgacgcggccgatggcgtggcg
agcgccgaacagctggccgccttcctgacccaggccgaccgcctgccgaccgcgccccgg
tcgctgagcaactcggccggcagcttcctggacgcccgcttccacttcgacctggtccgt
ccggggctggccctctacggcgcagagccgcacgaggtccccggccgggcgctggagccg
gtcgtttcgctgcaggcgcggatcatccagctgcgcgaagtcccggccggcgcccggatc
ggctacggctacagcttcgaggccccccgcccgatgcggctggccaccatcggcatcggc
tacgccgacggctggccccgcgcgctgagcaaccggggcgccgcctggcggggcgaggct
cgcctgccgatcgtcggccgcgtgtcgatggacagcaccatcctggacatctccgccctg
cccgccgacgcgctggttgagggcgacgacgtcgagctgatcggcctgcatcagtcgctg
gacgccgtcgcggccgcggccggctcgatcacccacgagatcctgacgggcctcggcccg
cgtctgcatcgcagctatcacggaacccagtcatga

DBGET integrated database retrieval system