KEGG   Caulobacter mirabilis: CSW64_16025Help
Entry
CSW64_16025       CDS       T05166                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00473  D-Alanine metabolism
cmb00550  Peptidoglycan biosynthesis
cmb01100  Metabolic pathways
cmb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CSW64_16025
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CSW64_16025
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CSW64_16025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cmb01011]
    CSW64_16025
Enzymes [BR:cmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CSW64_16025
Peptidoglycan biosynthesis and degradation proteins [BR:cmb01011]
 Precursor biosynthesis
  Amino acid ligase
   CSW64_16025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter RimK
Motif
Other DBs
NCBI-ProteinID: ATQ43793
UniProt: A0A2D2B0K6
LinkDB All DBs
Position
complement(3340306..3341253)
Genome map
AA seq 315 aa AA seqDB search
MSLPLQGHHVAVLLGGLSSEREVSLVSGAACAKALENLGAKVTRVDAGRDLAQVLTAVKP
DVVFNALHGEWGEDGCVQGVLETLGLPYTHCGVLSSALAMDKAKSKAVMAAAGVTVPGGG
LYNRHDVARDHVLPPPYVVKPNAEGSSVGVFIVREGANTPPQEVVAPSWTYGEEVMVEPY
IAGMELAVGVMDGKAQTVTEIIPRTDFYDYDAKYSEGGSQHVLPARIPQEAFDEALRLSE
LAHAALGCRGVTRSDLRYDPVKRLLVLLEVNTQPGMTPTSLVPEQAAHLGTSFDQLVLWI
VEDAYARGSAGGKAG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccctgcaaggtcaccacgtcgccgtcctgctgggcggcctgtcgtcggag
cgcgaggtcagcctggtctccggcgcggcctgcgccaaggcgctggagaacctgggggcc
aaggtcacccgcgtcgacgccggccgcgacctggcccaggtgctgaccgccgtgaagccg
gacgtggtcttcaacgccctgcacggcgagtggggcgaggacggctgcgtccagggcgtg
ctggagaccctgggcctgccctatacccactgcggggtgctgtcctcggccctggccatg
gacaaggccaagtcgaaggccgtcatggccgcggccggcgtcaccgtgcccggcggcggc
ctgtacaatcgccatgatgtcgcccgcgaccacgtcctgccgccgccctatgtcgtgaag
ccgaacgccgaggggtcctcggtcggggtcttcatcgtccgcgagggggccaacaccccg
ccgcaggaagtcgtggcgcccagctggacctacggcgaggaggtcatggtcgagccctac
atcgccggcatggagctggccgtcggggtcatggacggcaaggcgcagacggtgaccgag
atcattccgcgcaccgacttctacgactacgacgccaaatattccgaaggcggctcccag
catgtcctgccggcgcggattccgcaggaggctttcgacgaggccctgcgcctgtcggag
ctggcccacgccgctcttggttgccgaggggtgacccgaagtgatcttcgttatgaccct
gttaagcgtcttctggtccttttggaggtcaacacgcagcccggcatgacgcccacctcc
ctcgttccggagcaggcggcccatctggggacgtcgttcgaccaactggtgctctggatt
gtggaggatgcgtatgcccgcggcagtgcggggggcaaggcagggtaa

DBGET integrated database retrieval system