KEGG   Caulobacter mirabilis: CSW64_17920
Entry
CSW64_17920       CDS       T05166                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00520  Amino sugar and nucleotide sugar metabolism
cmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CSW64_17920 (nagA)
Enzymes [BR:cmb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CSW64_17920 (nagA)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-ProteinID: ATQ44130
UniProt: A0A2D2B1K0
LinkDB
Position
3795215..3796360
AA seq 381 aa
MITALVNGRVLTEAGVIEDRVVLIEDGRILALADAAPEGARIQDLSEGLLLPGFIDTQVN
GGGGVLFNDAPTVETIERIGAAHRRFGTTGFLPTLISDDLSVVRQAIKAVDEAIARGVPG
VLGIHVEGPFLNARRKGIHDSTKFRALDDEAFEVLTGLGRGRTLVTLAPETTTPETIARL
AAAGIIVSAGHTNATYATIRSALDNGLRGFTHLFNAMSPLTHREPGVVGAALEDRHAWCG
LIVDGRHVAPPVLRITMAARPRDRLMLVTDAMPSVGTDETTFVLQGRAISVRNGVCVDEH
GTLAGSHLDMASAVRNTVGLTGVSLAEASLMASGSPAAFLRLETERGAIAPGRRADLVLA
DDELRVFETWIDGRPSGARFA
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgatcaccgcgctcgtcaacggccgcgtcctgacggaagccggcgtcatcgaagatcgc
gtcgtcctcatcgaggacggccgcatcctggcgctcgccgacgccgcgccggagggcgcc
cggatccaggatctgagcgaggggctgctgctgcccggcttcatcgacacccaggtcaac
ggcggcggcggcgtgctgttcaacgatgcgcctacggtggagaccatcgaacggatcggc
gcggcgcatcgccgcttcggcacgaccggtttcctgccgaccctgatcagcgacgacctc
agcgtggtccggcaggcgatcaaggcggtcgatgaagcgatcgcgcgcggcgttccgggc
gtcctcgggatccacgtcgaagggcccttcctgaacgcccggcgaaagggcatccacgac
tcgaccaagttccgcgccctggacgacgaagccttcgaggtcctcaccggtctggggcgc
ggccgcaccctggtcaccctggcgcccgaaaccacgacgccggagacgattgctcgactg
gccgcagccggcatcatcgtctccgccggccacaccaacgccacctacgccaccatccgg
tcggcgctcgacaatggcctgcgcggcttcacccacctgttcaacgccatgtccccactg
acccatcgcgagccgggcgtggtcggcgcggcgctggaagaccgccacgcctggtgcggc
ctaatcgtggatggccgccacgtcgccccgccggtcctgcggatcaccatggccgcgcgc
ccgcgcgatcgcctgatgctggtcacggacgcgatgccgagcgtcggcaccgacgagacg
acattcgtccttcagggccgcgcgatcagcgtccgcaacggcgtctgcgtcgatgagcac
ggcacgctggcgggatcccacctcgacatggcctcggcggtgcgaaacaccgtcggcctg
accggcgtctcgctggccgaggcgtcgctcatggcgtccggctctccggcggccttcctg
cggctggaaacggaacgcggcgccatcgcgccgggccgacgcgccgatctggtgctggcg
gacgacgagttgcgggtgttcgagacctggatcgacggccgcccttcgggagcccgcttc
gcctag

DBGET integrated database retrieval system