KEGG   Caulobacter mirabilis: CSW64_20865Help
Entry
CSW64_20865       CDS       T05166                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00061  Fatty acid biosynthesis
cmb00780  Biotin metabolism
cmb01100  Metabolic pathways
cmb01130  Biosynthesis of antibiotics
cmb01212  Fatty acid metabolism
Module
cmb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CSW64_20865
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CSW64_20865
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CSW64_20865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmb01004]
    CSW64_20865
Enzymes [BR:cmb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CSW64_20865
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CSW64_20865
Lipid biosynthesis proteins [BR:cmb01004]
 Fatty acid synthase
  Component type
   CSW64_20865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ATQ44663
UniProt: A0A2D2B342
LinkDB All DBs
Position
4408372..4409190
Genome map
AA seq 272 aa AA seqDB search
MADDYSFPKGDLMKGKKALITGVANHNSIAWGIASQLAAQGAELAFAYLPDMEKRVRPLG
ESIGVKTFVPMEVTDDASMDAAFAQIESELGTLDAYLHSIAFANKDELKGSFVENTTREG
FLRAMNISAFSFVDTARRAARLMPNGGSMVTMTYLGAERVIPNYNTMGVAKAALEAATRY
IARDLGPKGIRVNAISAGAMRTLSLAGISGGRGMLSQGRAFSALKEDTSMEGVAGAALWL
LSELGRSTTGEVVHVDAGFHMIGLPDGESAEG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgactacagcttccccaagggcgatctgatgaagggcaagaaggccctgatc
accggggtggccaaccacaactccatcgcctggggcatcgcctcgcagctggccgcccag
ggcgccgagctggccttcgcctacctgccggacatggagaagcgcgtccgtccgctcggc
gagagcatcggcgtgaagaccttcgtcccgatggaggtcaccgacgacgcctcgatggac
gccgccttcgcccagatcgagagcgagcttgggacgctggacgcctatctccactcgatc
gccttcgccaacaaggacgagctgaagggctcgttcgtcgagaacaccacccgcgagggc
ttcctgcgggcgatgaacatctcggccttcagcttcgtggacaccgcccggcgcgcggcc
aggctgatgccgaacggcggctcgatggtcacgatgacctacctgggcgccgagcgggtc
attccgaactacaacaccatgggcgtggccaaggcggcgctggaggcggcgacccgctac
atcgcccgcgacctgggccccaagggcatccgcgtcaacgccatctcagccggcgccatg
cgcaccctgtcgctggccggcatctcgggcggccgcggcatgctgagccagggccgcgcc
ttcagcgccctgaaggaggacacctcgatggaaggcgtcgccggcgcggcgctgtggctg
ctgtcggagctgggtcggtcgaccacgggcgaagtggtccatgtcgacgccggcttccac
atgatcggcctgccggacggcgagtcggcggaaggctga

DBGET integrated database retrieval system