KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_01851Help
Entry
CMN_01851         CDS       T02530                                 

Gene name
pknE
Definition
(GenBank) Cmm ortholog CMM_1873; Cms ortholog CMS_1359
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmc01001]
    CMN_01851 (pknE)
Enzymes [BR:cmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CMN_01851 (pknE)
Protein kinases [BR:cmc01001]
 Serine/threonine kinases: Other
  Bacterial family
   CMN_01851 (pknE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Pkinase_fungal Kinase-like RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-ProteinID: CCE75796
UniProt: M5B9K9
LinkDB All DBs
Position
1946308..1948257
Genome map
AA seq 649 aa AA seqDB search
MTSSPTDPMIGRLLDGRYQVRSRIARGGMATVYVATDLRLERRVAVKVMHGHLADDSAFR
DRFIQEARSAARLAHPNVVNVFDQGQDSDMAYLIMEYLPGMTLRELLQEYERLTPEQTLD
ILEAVLSGLAAAHKAGIVHRDLKPENVLLADDGRIKIGDFGLARAVSANTATGQALLGTI
AYLSPELVTRGIADTRSDIYAVGIMMYEMLAGEQPFKGEQPMQIAYQHANDQVPTPSTAN
ASVPVELDELVLWATARDPEQRPRDARALLDELYAVQNRLDARSGDPAPLQRTVVFPSAP
ALPSVTTGETQVVGGPPVMTRQEDERTEPESVVALAAAGSRRRSRGWMLALLVVMLAALA
GGTGWYYGQGPGARIPVPSVTAMAIDDAAGTLQGQGFVVARAEEPSVDVEVGHVTRSVPA
SGTPVDQGSTVTVYASTGPRLLDVPDVVGAAEADARTRLEGVPFVVQEATIRQYGDAAEG
TVVQVLDSSGAPVAAQYPEQQTVTLVVAAGKIPQVNGRSVDQAKATLAQAGLVGEPGKQS
FSDDVDAGEVISVYQLDQNPVRSGLGDAPGSKVGLEISKGPDLVAVPNVVGLTRDGAKAA
LDKAGFTYAYSTFWDAVPDGITKVVSASPDAGAMVRRGSTVNLGITASG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccagcccgaccgaccccatgatcggccgtctcctcgacggtcggtaccaggtc
aggtcccgcatcgcacgcggcgggatggcgacggtctacgtggcgaccgacctgcggctg
gagcgtcgcgtcgccgtcaaggtgatgcacgggcacctcgccgacgacagcgcgttccgg
gaccgcttcatccaggaggcgcgctcggccgcgcggctggcgcaccccaacgtcgtcaac
gtcttcgaccagggccaggactccgacatggcgtacctcatcatggagtacctgcccggc
atgacgctgcgcgagctgctgcaggagtacgagcggttgacgcccgagcagacgctcgac
atcctcgaggccgtgctctcgggtctcgccgccgcgcacaaggccggcatcgtgcaccgc
gacctgaagcccgagaacgtgctgctggccgacgacgggcgcatcaagatcggcgacttc
ggcctggcgcgcgccgtcagcgcgaacacggccacggggcaggcgctcctcgggaccatc
gcgtacctctcccccgagctcgtgacgcggggcatcgccgacacccgcagcgacatctac
gccgtcggcatcatgatgtacgagatgctcgcgggcgagcagcctttcaagggcgagcag
cccatgcagatcgcgtaccagcacgcgaacgaccaggtgcccacccccagcacagccaac
gcgtccgtgccggtcgagctcgacgagctggtcctgtgggcgaccgcgcgagatcccgag
cagcggccccgtgacgcccgggcgctcctcgacgagctctacgccgtgcagaaccgcctc
gacgcgcggtcgggcgacccggctccgctccagcgcaccgtcgtcttcccgagcgccccg
gcgctcccctccgtcacgaccggcgagacgcaggtcgtgggcggtccgcccgtcatgacg
cggcaggaggacgagcgcaccgagccggagtccgtcgtcgcgctcgccgccgccggctcg
cgccgtcgatcgcgcgggtggatgctcgcgctcctcgtggtgatgctcgccgccctcgcc
ggcggcacgggttggtactacgggcagggcccgggcgcgcgcatcccggtgccgtccgtg
acggccatggccatcgacgacgccgccggcaccctccagggccagggcttcgtcgtcgcg
cgcgccgaggagccgagcgtggacgtcgaggtggggcacgtgacccggagcgtcccggct
tccgggacgcccgtcgaccagggatccaccgtgaccgtctacgcctcgaccggaccgcgg
ctcctcgacgtgcccgacgtggtcggggccgccgaggccgacgcccggacgcgcctggag
ggcgtgcccttcgtcgtgcaagaggcgaccatccggcagtacggcgacgccgccgagggc
accgtcgtgcaggtgctggactcctcgggagcccccgtcgccgcccagtacccggagcag
cagacggtgaccctggtggtcgccgccgggaagatcccccaggtgaacggccgctccgtc
gaccaggccaaggcgacgctcgcccaagcggggctcgtcggcgagccggggaagcagagc
ttcagcgacgacgtcgacgcgggcgaggtcatctccgtctaccagctggaccagaacccg
gtgcgctccggtctcggcgacgcccccggcagcaaggtggggctcgagatctccaagggg
ccggacctcgtggccgtgccgaacgtagtcggcctcacgcgcgatggagcgaaggccgcg
ctcgacaaggcgggcttcacgtacgcgtactccacgttctgggatgcggtgccggacggc
atcacgaaggtggtgtcggcgagcccggatgcgggcgccatggtccgccgtggctccacc
gtcaacctcggcatcaccgcctccggctga

DBGET integrated database retrieval system