KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02125Help
Entry
CMN_02125         CDS       T02530                                 

Gene name
pknF
Definition
(GenBank) Cmm ortholog CMM_2158; Cms ortholog CMS_1851
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CCE76066
UniProt: M5BDM9
LinkDB All DBs
Position
2242612..2243880
Genome map
AA seq 422 aa AA seqDB search
MPGERPDPLAGTLLAGRYRISGLLGRGGMATVYRASDETLGREVAVKVFATDSADPAEVE
RQEGEVRMLAGLSHPGLVTLFDVGDDVVADRVLAFIVMEIVDGTTLADRMKEGPLPGPEV
ARIGGILADALGYIHRRGVVHRDVKPANVLLARPEEDDEPAAAKLTDFGIARLVDGTRLT
STGSIVGTVSYLSPEQALGEEVGAPTDVYALGLVLLECLTGRRTFPGTAAESTMARVVRD
PEIPARLGASWVDLLGRMTRRDPAMRPTAREVTAELRTGRAPDSAVDAPTATSTRVMPAA
AAAGFGAAGAGAAAASAAPSADRDARTERFAAASSPSAAYGDDPTARTDPAEGRPGADRV
PAKRRGSRALSIAVVSVLIAAAAVVGVVTVQSLQTQDTSYPSVPGPLGASLEELQKSVED
AP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcccggagaacggcccgacccgctcgccggcacgctgctggccggccgctaccgcatc
agcgggctgctcggacgcggcggcatggccaccgtgtaccgcgcatccgacgagacgctc
ggccgcgaggtcgccgtcaaggtcttcgcgaccgactccgccgacccggccgaggtcgag
cgccaggagggcgaggtgcgcatgctcgccggcctcagccacccgggcctcgtgaccctg
ttcgacgtgggcgacgacgtcgtcgccgaccgcgtgctcgccttcatcgtgatggagatc
gtcgacggcaccacgctcgccgaccgcatgaaggaggggccgctgcccgggcccgaggtc
gcgcgcatcggcgggatcctcgcggacgcgctcggctacatccaccgccgcggcgtcgtg
caccgcgatgtgaagcccgccaacgtgctgctcgcccgacccgaggaggacgacgagccg
gccgccgccaagctcaccgacttcgggatcgcgcggctcgtggacggcacgcgcctcacg
tcgaccggatccatcgtcggcaccgtgagctacctcagccccgagcaggcgctcggcgag
gaggtgggcgcgcccaccgacgtctacgcgctcggcctcgtgctcctcgagtgcctcacc
ggccgccgcaccttcccgggcacggccgccgagtcgaccatggcgcgcgtggtccgcgac
ccggagatcccggcccgcctcggcgcctcgtgggtggacctcctcggccgcatgacccgg
cgcgatcccgcgatgcggcccactgcgcgcgaggtcaccgcggagctgcggaccgggcgc
gcgcccgactccgcggtggacgcgcccacggccacgtcgacgcgggtgatgccggccgcc
gctgccgccgggttcggtgccgccggcgcgggtgcggccgctgcctccgccgcgccgtcc
gcggatcgggacgcccggaccgagcggttcgccgccgcgtcgtcgccgtcggccgcgtac
ggcgacgacccgaccgcgaggaccgacccggccgaaggccgccccggcgcggatcgcgtc
ccggcgaagcgccgcggcagccgggccctcagcatcgcggtcgtgtccgtgctgatcgcc
gcggcggccgtcgtgggcgtcgtgaccgtgcagtcgctgcagacccaggacacctcctac
ccgtcggtccccggacccctcggcgccagcctcgaggagctgcagaagagcgtggaggac
gccccgtga

DBGET integrated database retrieval system