KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02492Help
Entry
CMN_02492         CDS       T02530                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
cmc00020  Citrate cycle (TCA cycle)
cmc00480  Glutathione metabolism
cmc01100  Metabolic pathways
cmc01110  Biosynthesis of secondary metabolites
cmc01120  Microbial metabolism in diverse environments
cmc01130  Biosynthesis of antibiotics
cmc01200  Carbon metabolism
cmc01210  2-Oxocarboxylic acid metabolism
cmc01230  Biosynthesis of amino acids
Module
cmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMN_02492 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CMN_02492 (icdA)
Enzymes [BR:cmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CMN_02492 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: CCE76427
UniProt: M5BDV0
LinkDB All DBs
Position
complement(2634167..2635381)
Genome map
AA seq 404 aa AA seqDB search
MEKIKVEGTVVELDGDEMTRIIWQSIKDTLIHPYLDIDLEYYDLGIEKRDETDDQITIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKRMWRSPNGTIRNILGGTIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTMTFTPKDGSEPQQFEVFQSPGSGVAMG
MYNLDDSIRDFARASLSYGLARNYPVYLSTKNTILKAYDGRFKDLFQEVFEAEYKEQFDA
AGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGK
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLAHRAKLDGNDALRTFADTLED
VVITTVESGKMTKDLALLVGPDQPYQTTEEFLASLAENLQTRLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaaggtagaggggaccgtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagtccatcaaggacacgctcatccacccgtacctcgacatcgacctcgag
tactacgacctgggcatcgagaagcgcgacgagaccgacgaccagatcacgatcgacgcg
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctgaagaggatgtggcgctcgccgaacggcaccatccgc
aacatcctgggcggcacgatcttccgcgagcccatcatcatcagcaacatcccgcgcctc
gtgcccggctggaacaagccgatcatcgtcggccgccacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctcacgatgaccttcacgccgaaggac
ggctccgagccgcagcagttcgaggtgttccagagccccggatccggcgtcgcgatgggc
atgtacaacctcgacgactcgatccgcgacttcgcgcgcgcgtcgctctcgtacggcctc
gcccgcaactaccccgtctacctctccaccaagaacacgatcctcaaggcctacgacggc
cgtttcaaggacctgttccaggaggtcttcgaggccgagtacaaggagcagttcgacgcc
gccggcctcacgtacgagcaccggctcatcgacgacatggtcgccgcctcgctcaagtgg
gagggcggctacgtctgggcgtgcaagaactacgacggggacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctcatgacgagcgtgctcaccacgcccgacggcaag
gtcgtcgaggcggaggccgcgcacggcaccgtcacgcgccactaccgccagcaccagcag
ggcaagcccacctcgacgaaccccatcgcgtccatctacgcctggacccggggtctcgcg
caccgcgccaagctcgacggcaacgacgcgctgaggacgttcgcggacaccctcgaggac
gtcgtcatcacgacggtcgagagcggcaagatgacgaaggacctcgcgctcctcgtcggc
ccggaccagccgtaccagacgaccgaggagttcctcgcgtcgctcgcggagaacctgcag
acgcgcctggcctga

DBGET integrated database retrieval system