KEGG   Corynebacterium maris: B841_07560Help
Entry
B841_07560        CDS       T02784                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cmd  Corynebacterium maris
Pathway
cmd00010  Glycolysis / Gluconeogenesis
cmd00520  Amino sugar and nucleotide sugar metabolism
cmd01100  Metabolic pathways
cmd01110  Biosynthesis of secondary metabolites
cmd01120  Microbial metabolism in diverse environments
cmd01130  Biosynthesis of antibiotics
cmd01200  Carbon metabolism
Module
cmd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B841_07560
   00520 Amino sugar and nucleotide sugar metabolism
    B841_07560
Enzymes [BR:cmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     B841_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGS34985
UniProt: S5T313
LinkDB All DBs
Position
1631896..1632690
Genome map
AA seq 264 aa AA seqDB search
MSHTSAASSATQNDTATTAFGVDVGGSGIKGAIVDLTTGEFIGDRIKILTPQPATPDAVA
ETIAELLDRAEWEGPVGITLPSVVKDRVALTAANIDPSWVGADTGELFDRHLPGREVTVL
NDADAAGLAEVAHGNPVAGAGSVIFLTFGTGIGSAMLLDGQLFPNTELGHLVIDGQEAEW
TASSAVKEREELSFKKWAKRVNAVLTEYERLFYPDAFIVGGGISRDHEKWVPRLDLRTPV
HAAQLRNRAGIVGAAMAVSRHLAP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacacctcagcggcttcttccgcgacgcagaacgacaccgccaccaccgctttc
ggagtggacgtgggtggctccggcatcaaaggcgcgatcgtcgacctgaccaccggcgaa
ttcatcggcgaccggatcaagatcctgaccccgcagccggccaccccggacgccgtggcc
gagaccatcgccgagctgctggaccgcgccgaatgggagggcccggtcgggatcacgctg
ccgtcggtggtcaaagaccgggtcgcactcaccgccgccaacatcgatccgagctgggtg
ggcgccgacaccggtgagctcttcgaccggcacctgccgggccgggaggtcacggtgctc
aacgacgcggacgccgccggcctcgccgaggtcgcccacggcaaccccgtcgcgggcgcc
ggcagcgtgattttcctgactttcggcaccggcatcggctcggcaatgctgctggacggg
cagctcttcccgaacacggaactcgggcatctcgtcatcgatggccaggaggcggagtgg
accgcctcgtccgccgtgaaggagcgcgaggaactgagcttcaagaagtgggcgaagcgc
gtgaacgccgtgctgacggagtacgagcgtctgttttacccggacgccttcatcgtcggt
ggcgggatttcccgggatcacgagaaatgggtcccccggctggacctgcgcaccccggtg
catgcggcccagctgcgcaaccgggcgggcatcgtgggcgccgcgatggcggtgtcccgg
catctggctccgtag

DBGET integrated database retrieval system