KEGG   Cyanidioschyzon merolae: CYME_CML209CHelp
Entry
CYME_CML209C      CDS       T00175                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00564  Glycerophospholipid metabolism
cme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CYME_CML209C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CYME_CML209C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 Pyr_redox_2 Pyr_redox HI0933_like GIDA 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 16994620
NCBI-ProteinID: XP_005536841
UniProt: M1V5K0
LinkDB All DBs
Position
12:524890..526959
Genome map
AA seq 689 aa AA seqDB search
MMPCVRMRRSFSKIALCSAAAFVSSATVLLLGGYDSRWYTPLVARAHSASVASVDHGPLP
VLETPPRRHAQLRVLKESGMRYESVQKRKAEAGGDGSSKEAMSAVVPSALPEDGLFDILV
VGGGATGSGVALDATLRGLRVALVERNDFASGTSSRSTKLIHGGVRYLEKAFFRADPAQL
KLVFEALHERAIMLRQAPHLTQPLPTILPCYKWWEIPFYWAGLKAYDFLAIAGNGALYMS
KFLSAAEARRQFPTLSARRGRDGATLKGSIVYYDGQMDDARFNVTLAVTAALHGAVIANH
TEVSGLIKDASTGKVIGATVRDRFTGEEFPVYARVIVNATGPFADRIRAMDEGPEALGPQ
RMIVPSSGVHVTLPSYYSPEGMGLIVPKTRDGRVVFMLPWLGSTIAGTTDSSTEITDMPR
PHEAEIEFILDALRDYLNVEVRRKDVQSAWSGIRPLAIDPKAKDTQNILREHTVHVSGSG
LLTIAGGKWTTYRKMAQDTVDTAIKVAMLESRVKHKCLTEKVILTGGHTYDPSYFAFLTQ
HYERVKYSVSKGAKLQTTTLDVDIAQHLARAYGDQAYKICDIASREDAGYGKRIAHGYPY
IEAEVVYAAENEYCETAQDFLARRSRLAFLNARAAKEALPRIAEILAEIHGWSRTRLQTE
MKEAMEFLETFESGRTTGEVGEQVEAVAA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctgcgttcgtatgaggcgttcgttttcgaaaatagcgctgtgttccgctgcg
gcttttgtttcgtctgcaacggtgctgttgcttggcgggtatgactcgcgatggtacacc
cctttggttgcgagagcgcactcggctagcgtggcgtctgtggaccacgggccgttgccg
gtgctcgagacgccaccgcgtcgtcacgcgcagctgcgagtgttaaaagagagcggcatg
cgttatgaatctgtccaaaaacggaaagccgaagctggaggcgacggctcatcaaaagag
gctatgagtgcagtggtaccgagcgctttgccggaagacggcctcttcgatattctcgtc
gttggtggcggcgcgaccggctccggcgttgcactcgacgcaacgctccgtggactccga
gttgctctagtagagcggaacgatttcgcgtctggcacgtcgtctcgttcgacgaaactc
attcatggtggtgtccggtacttggaaaaggcgttctttcgtgctgaccctgcgcaacta
aagctcgtcttcgaagctttgcatgagcgagcgatcatgctccgtcaagcgcctcacttg
acacaaccgctgccgacgatcctgccgtgttacaaatggtgggagatcccattctattgg
gctgggctcaaggcctacgactttctggccatcgcaggcaatggcgcgctctatatgagc
aagttcctctcggcggcggaagcgcggcgtcagtttccgaccctttcagcgcgccgtggc
cgggacggcgccaccctcaaaggcagtattgtgtactacgatggccagatggatgacgcg
cgattcaatgtgacgcttgcagtgacggcggcgctacacggggcagtgattgcaaatcac
actgaagtttcgggcttgatcaaggatgcctcaactggaaaggtcattggcgcaacagtt
cgtgatcgtttcaccggagaagaatttccggtctacgcgcgagtgattgtgaacgcaacc
ggcccgtttgcggatcggatacgagcgatggacgagggacctgaggcgctcggtccccaa
cgcatgatagttccgtcatctggggtgcacgttactctgcccagttactattctccggaa
ggcatgggtttgattgtaccaaaaacgcgcgacggtcgggttgtcttcatgttgccatgg
ttgggatcgacaattgccggcaccacggattcaagcacggagattacggacatgccacgt
ccgcatgaggcggagattgagtttatcttagacgcgcttcgtgattatctgaacgtggaa
gtgcgtcgaaaggatgttcagagcgcatggagtggtattcgaccgcttgcaatagacccc
aaagcgaaggacacacagaatatccttcgtgagcacacagtccacgtctctggctcgggt
ctgctgaccatcgcgggtggcaaatggacgacttaccgaaaaatggcacaggacactgtg
gatactgctatcaaagttgcaatgttggagtctcgcgtgaagcacaagtgcttgacagag
aaggtcatcctcaccggaggtcatacttatgacccgtcgtatttcgcttttctcacgcag
cactatgaaagagtgaaatactctgtcagtaagggtgccaaactccagaccacgacgctg
gacgtagacatagcgcaacatcttgctcgagcctacggagatcaagcttacaagatctgc
gatattgcgagcagggaagatgctggttacggcaaacgcattgcgcatggctacccgtat
attgaagcagaggtcgtgtacgcagctgaaaacgaatactgtgagacagcccaggacttt
ttggcgagacgctcgcgtcttgcgtttctgaacgcccgggcggcgaaagaggcgcttccc
cgcatcgctgagattctcgctgagatccacggctggagtcgcacccgcttgcagacggaa
atgaaggaggcaatggagtttctcgagacgtttgagtccggtcgtacgactggtgaggtc
ggtgaacaggttgaagcagtggccgcataa

DBGET integrated database retrieval system