KEGG   Cyanidioschyzon merolae: CYME_CMQ006C
Entry
CYME_CMQ006C      CDS       T00175                                 

Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00523  Polyketide sugar unit biosynthesis
cme01100  Metabolic pathways
cme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CYME_CMQ006C
   01055 Biosynthesis of vancomycin group antibiotics
    CYME_CMQ006C
Enzymes [BR:cme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     CYME_CMQ006C
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 Sacchrp_dh_NADP Methyltransf_2 NmrA
Other DBs
NCBI-GeneID: 16996381
NCBI-ProteinID: XP_005537980
UniProt: M1URZ4
LinkDB
Position
17:15674..16804
AA seq 376 aa
MSSQSTALSNGAKSVTGGQPDGNSDARVVYGDRLRFVPRNILVTGGAGFIASHVVERLVS
RYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIRGDIRSHDLVLYVLQEECIDTVLHFA
ACTHVDNSFTSSILFTENNVLGTHVLLECARQYGKVRRFIHVSTDEVYGGESNMETESSI
LAPTNPYACSKAAAEFICRGYVKSFGLPVIITRGNNVYGPHQFPDKLIPKSICLLAQRRP
CFVHGSGEHARNFLYVEDAASAFDTILHCGETDEVYNVGSEIEKRNIDVVHDIIDLFGLS
AEANRHIEFVKDRTLNDMRYRIDSSKLHALGWRPQVSWEEGLRRTKTWYCDPNNLKRWPN
YLSGLVPHPSLTEEKH
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtcctcgcagagcacggcgctttcgaacggtgccaagtcggtaaccggtggacagccc
gacgggaactcggacgcgcgggtcgtctacggcgaccgtctgcgcttcgtgccgcggaat
atccttgtgactggcggtgccggctttattgcctcgcacgttgtcgaacggctcgtgagt
cgatatccccattaccgcgtgacggtactggacaagctcgactactgctcgtcgctgagc
aacctcgcgcaggtggcaaaccgaccaaacttcaagtttattcgcggcgatatccgctcg
catgacctggtgctctacgtgctccaggaggagtgcatcgatacagtgctccactttgcg
gcgtgcacgcacgtcgataactcgttcacgtcctcgatcctgtttacggagaacaacgtg
ctgggaacgcacgtcctcctggagtgcgcacgccagtacggcaaagtgcggcgcttcatt
cacgtcagcaccgatgaggtgtacggcggcgagagcaacatggagacagagtcatcgatc
ctggcacccacgaacccgtacgcatgtagcaaggccgccgctgaattcatttgccgcggc
tacgtcaagtcgttcggattgccggtgatcatcacacgcggcaacaacgtgtacgggccg
caccagttccccgacaagctcattcccaagagtatctgtctgctggcgcaacgccggccc
tgctttgtacacggctctggtgagcatgcacgcaactttttgtacgtcgaggacgcggcg
agcgcctttgacaccatcctgcattgtggcgagaccgatgaggtctacaatgtaggctct
gagatcgagaaacgcaacattgacgttgtgcacgacattatcgatctcttcggcctgtct
gccgaggcgaaccgccacatcgagtttgtcaaagatcgcaccctcaacgatatgcgctac
aggatcgactcgtcgaagctgcatgcgcttggctggaggccgcaggtgtcctgggaagag
ggcctgcgccgaaccaagacctggtactgcgatccgaataacctgaagcgctggccgaat
tatctcagtggcctcgtaccgcatccgagtctcaccgaggagaagcactag

DBGET integrated database retrieval system