KEGG   Cyanidioschyzon merolae: CYME_CMT582CHelp
Entry
CYME_CMT582C      CDS       T00175                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00020  Citrate cycle (TCA cycle)
cme00190  Oxidative phosphorylation
cme01100  Metabolic pathways
cme01110  Biosynthesis of secondary metabolites
cme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CYME_CMT582C
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CYME_CMT582C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CYME_CMT582C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 16997780
NCBI-ProteinID: XP_005539527
UniProt: M1UY25
LinkDB All DBs
Position
20:complement(1478666..1480741)
Genome map
AA seq 691 aa AA seqDB search
MTLVHSLRVFLSRRSFTKEAARRLPRHVTSIGAFPREERLLARSKQRIIALVCGQQRRAL
GQLVRSARPAVDTESPARAKRRVATQATPSYAVVEHEYDAVVLGAGGAGLRAVIGCAEAG
LKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCR
EAPKVVIELEHYGVPFSRTEDGRIYQRAFGGQSLKFGKGGQAYRCAAAADRTGHALLHTL
YGQALKHNADFFVEYFGLDLIMDEEGVCRGLMALCLEDGTIHRFRSHAVIICTGGYGRAY
FSATSAHTCTGDGNAMAVRAGIPLQDMEFVQFHPTGIYGAGCLITEGCRGEGGILRNGVG
ERFMERYAPSAKDLASRDVVSRAMTLEIMEGRGCGPQKDHIQLFLNHIPPEILKERLPGI
METARIFAGVDVTKEPIPVLPTVHYNMGGIPTNWRGEVLRPTASDPDAVVPGLLAAGEAA
CASVHGANRLGANSLLDIVVFGRACAHAVAEQVRPGMPHKPLPANAGEDAIANLDRFLHA
NGSIKTADLRLRMQKIMQNHAAVFRAKDTLEEGCKLIDECYSDLNEVRIADRSLIWNTDL
IETLELQNLLQNAVATMHSAEQRKESRGAHARDDFPKRDDEHWMKHTLAWVHAQDALPAN
ASPVRIGYRPVHDWSLDESEQTPFPPAQRVY
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgtgcattctttgcgcgttttcttgtcgaggcgcagtttcaccaaagaagct
gcgaggcgtttgcctcgacacgtcaccagcatcggtgcgtttccgcgtgaagagcgactg
ctggcgcgttccaaacaacgcattatagcgctcgtgtgcggccaacaaaggcgcgcactt
ggtcagctcgtgcgaagtgctcgtcctgcggtagacaccgagtcaccggcgcgagcgaag
cgacgcgttgctacccaagcgacaccatcctacgctgtggtggaacacgagtacgacgct
gttgtgctgggcgctggcggtgcaggcctccgagcagttattggctgtgctgaggccggt
ttgaaaaccgcctgtgtcacgaaactgtttccaacgcgctcccacaccgttgccgcacaa
gggggtatcaacgctgcgcttgggaacatgaccgaggatgactggcgctggcacatgtac
gatacggtgaaaggtagcgattggctcggagatcaggacgcgattcactatatgtgtcga
gaagcgccgaaggttgtcatcgagttagagcactacggcgtgcctttttcgcgtacggaa
gatggccgtatctaccagcgggcgtttggtggccaaagtttgaagttcgggaaaggtgga
caagcatatcgctgcgctgctgccgcggaccgcacggggcacgcgctcttgcacacactc
tacgggcaagcgctgaaacacaatgcggatttcttcgtggagtacttcggtctagatctg
atcatggacgaggaaggagtctgccgcggtctgatggcgctctgtctagaggacggtacg
attcaccgtttccggtcccatgcggtgattatctgcactggtggctacggaagagcgtac
ttctcggcaacttcagcgcacacttgcacaggcgatggtaacgccatggctgtccgtgct
ggtataccactgcaagacatggagtttgtacagttccacccgacaggaatctacggcgca
ggttgcctcataacggaaggctgccgcggtgaaggcggtatcctgcgaaatggcgttggt
gaacgtttcatggaacgctatgcacctagcgcgaaagacttggcaagtcgtgatgtcgtc
tcgcgtgcgatgaccctcgagatcatggagggtcgcggatgtggaccccagaaggatcat
attcaactgtttctgaatcatattcccccagagattttgaaggaacgtcttcctggtatt
atggagaccgcacgcatctttgctggtgtcgacgtcaccaaagagccgattcccgtcctt
ccgacggttcactacaatatgggcggcatcccgaccaactggcgaggtgaagtcctgcgc
cccacagcatcggatccggacgcagtcgtgccgggtcttctcgcagctggagaagccgcc
tgcgcttctgtccatggcgccaatcgccttggcgcaaattccctgctggatattgttgta
tttggacgtgcttgtgcgcatgctgtggcggagcaagttcgcccgggaatgcctcacaag
ccgctgccggcgaatgccggtgaagacgctatcgcgaacttggatcgctttctccacgcg
aacgggagcatcaagaccgcggacttgcgtctgagaatgcagaaaatcatgcagaaccat
gcagctgtcttccgggcgaaagacacactggaagaaggatgcaagctgatcgacgagtgc
tactcggacttgaatgaggtgcgtattgccgatcgatccctaatctggaatacggatctg
atcgaaacattagaactgcagaatctgctccagaatgccgtagccacgatgcacagcgca
gagcaacgcaaggagtcacgaggtgcgcacgcgcgcgacgactttcccaagagagacgat
gagcactggatgaagcatacactggcatgggtacatgcacaggacgcgctgcctgcgaac
gcgtcaccagtgcggataggctatcgacccgtccacgactggagcctcgacgagagcgag
cagacgccttttccaccggcgcaacgggtttattaa

DBGET integrated database retrieval system