KEGG   Caminibacter mediatlanticus: FE773_05280Help
Entry
FE773_05280       CDS       T05985                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cmed  Caminibacter mediatlanticus
Pathway
cmed00790  Folate biosynthesis
cmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmed00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FE773_05280 (folP)
Enzymes [BR:cmed01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FE773_05280 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: QCT94607
UniProt: A0A4P9DVG8
LinkDB All DBs
Position
959202..960362
Genome map
AA seq 386 aa AA seqDB search
MRVYRLNCDIDLKRVMLKIGVDKPGIEIMKKKKCEFIFYIKDITCGAANILKQDALSIGA
ELAVPRGVPDCTNKIFDAILLCNKKQLEILSKKELAQPFKLKELAKSLREFINLPTFPTK
IMGVINANDDSFFEGSRFKGNDAILKIEEMIENGAKMIDIGGVSSRPGSEYVGREEELRR
VKPIIDEIYKSRLYEKAIFSIDTFDEVVLEYALDRGFKIANDITGLERDEYAKVAGKYGA
SVVIMHKKGDPKDMQNNPFYENVILEIDEFFSERVKKAKNFGIKDIILDVGIGFGKRLED
NIALIKHLGHFLHFGYELLIGASRKSMIDMIMQKENVKTTPADRLPGTLAIHLESIRNGA
SIIRCHDVKEHFQAIKVYEAIKEFDV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgagagtttatagattaaattgcgatatagatttaaaaagagttatgttaaaaatagga
gttgataaaccaggtattgaaattatgaaaaaaaagaagtgtgaatttattttttatata
aaagatataacttgtggggcggcaaatatactaaaacaagatgctttaagtattggagct
gagcttgcagtcccaagaggggtgccagattgtacaaataaaatttttgatgcaatttta
ctttgtaataaaaaacagcttgaaattttaagtaaaaaagaacttgctcaaccttttaaa
ttaaaagagttagctaaaagtttaagagagtttattaatttaccaacttttcctactaaa
attatgggtgtaattaatgcaaatgatgatagtttttttgagggaagtagatttaaagga
aatgatgctattttaaaaatcgaagagatgatagaaaatggagccaaaatgattgatatt
ggtggagtttcaagtaggcctggaagtgagtatgttggaagagaagaagaacttagaaga
gttaaacctattattgatgaaatttataaatcaagactctatgaaaaggctatttttagt
attgatacatttgatgaagtagtattagaatatgcacttgatagaggatttaaaatagca
aatgatataacaggacttgaaagagatgaatatgcaaaagtagctggtaaatatggagca
tcagttgttattatgcataaaaaaggagacccaaaagatatgcaaaataacccattttat
gaaaatgtgatattagaaatagatgagttttttagtgaaagagtaaagaaggctaaaaat
tttggaattaaagatattattttagatgttggaattggttttggaaaaaggctggaagac
aatattgcattaattaaacatttaggacattttttacactttggatatgaactattaatt
ggagcaagtagaaaatctatgattgatatgattatgcaaaaagaaaatgttaaaacaacc
cctgctgatagacttcctggtactcttgctattcatcttgaatctattagaaatggagcg
agtattattagatgtcacgatgtaaaagagcattttcaagcaataaaagtttatgaagca
attaaggagtttgatgtatag

DBGET integrated database retrieval system