KEGG   Clavibacter insidiosus: VO01_09615Help
Entry
VO01_09615        CDS       T03862                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cmh  Clavibacter insidiosus
Pathway
cmh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cmh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    VO01_09615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmh03400]
    VO01_09615
Enzymes [BR:cmh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VO01_09615
DNA repair and recombination proteins [BR:cmh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     VO01_09615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase FUSC
Motif
Other DBs
NCBI-ProteinID: AJW79348
UniProt: A0A0D5CI80
LinkDB All DBs
Position
2020521..2023031
Genome map
AA seq 836 aa AA seqDB search
MAGAKQQVEVEGRRITLTNLDKVLYPATGTTKGDVIAYYAAVAPHMLPHLRDRPVTRKRW
VDGVGTDEAPGKMFFQKDLDAHTPDWVQRRAIQHRDHANDYPLVGDVATLTWLGQIAALE
LHVPQWRFGRTGDERRPDRLVLDLDPGPGAGLPECVEVATAARAILRDMGLEPYPVTSGS
KGIHLYAALDGSHDADAISEVAHELARALEADHPDLVVSDMRKALRQGKVLVDWSQNNPN
KTTVAPYSLRGRSRPTVAVPRTWRELASPTLRHLELDEVVARMRKREDPLAPVEAGHRES
LEPTRERLAGFARREPSDAADDRLATYRSKRDAAKTSEPVPADAPAPSDGRSFVIQEHHA
RALHWDFRLEHDGVLVSWALPKGVPTEHGTNHLAVQTEDHPLEYGSFEGTIPAGEYGGGE
VTIWDAGTFDLEKWRDGKEVIATLHGRGDGTGIDGPRRYALIHTGGHGKADANWLIHLME
PADAPAAHHPKPARPAALAKAGGRTRVGARRKGGAASAPAPMLATAATGAGLDPDEEWAV
EMKWDGYRAITVVADGRATITSRNGVDLTAAFPELAELPDQLAVDAAVLDGEIVVLGDGG
RPDFGLLQTRLGLTGEKEIARARKAAPVHLMLFDALAIGDRVLVDEPYRERRAALLDAVR
APGRGRIQVPPAFDGDLDGALATSRELGLEGVVAKRVDAPYESGRRSSAWLKIKHHRAQE
VVVGGWRPGPGSRSSGIGSLLVGVPGPDGLMYAGRVGTGLTERDLADALRRFRPLARKTS
PFADVPAADARDAHWITPRLVGEVEFAEWTSTGRLRQASWRGWRHDKSPDEVVRED
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgaagcagcaggtggaggtcgaggggcggcggatcacgctcacgaacctc
gacaaggtgctgtacccggccaccggaacgaccaagggcgacgtcatcgcgtactacgcc
gccgtcgcgccgcacatgctcccgcacctccgcgaccggcccgtgacccgcaagcgctgg
gtcgacggcgtcggcaccgacgaggcgccggggaagatgttcttccagaaggacctcgac
gcgcacacgcccgactgggtgcagcggcgggcgatccagcaccgcgaccacgcgaacgac
tacccgctcgtcggcgacgtcgcgacgctcacctggctcgggcagatcgcggcgctcgag
ctgcacgtgccgcagtggcggttcggccgcacgggcgacgagcggcggcccgaccggctc
gtgctcgacctcgacccgggcccgggcgccggcctccccgagtgcgtcgaggtcgcgacg
gcggcccgcgcgatcctccgcgacatgggcctcgagccgtacccggtgacgagcgggtcc
aagggcatccacctgtacgccgccctcgacggcagccacgacgcggacgcgatctccgag
gtcgcgcacgagctggcgcgcgcgctcgaggccgaccatcccgacctcgtcgtgagcgac
atgaggaaggcgctgcggcagggcaaggtgctcgtcgactggagccagaacaaccccaac
aagacgacggtggcgccgtactcgctgcgcgggcgctcccggccgacggtcgccgtgccg
cgcacctggcgcgagctcgcgtcgccgacgctccggcacctggagctggacgaggtggtc
gcgcggatgcggaagcgcgaggatccgctcgcccccgtcgaggcgggccaccgcgagagc
ctggagccgacgcgcgagcggctcgcgggcttcgcgcggagggagccgtccgacgccgcc
gacgaccggctcgcgacctaccggtcgaagcgcgacgccgcgaagacgagcgagcccgtt
cccgccgacgcgcccgcgcccagcgatggccgctccttcgtgatccaggagcaccacgcc
cgcgcgctgcactgggacttccggctcgagcacgacggcgtgctcgtgagctgggccctc
cccaagggcgtgcccaccgagcacggcacgaaccacctcgcggtgcagaccgaggaccac
ccgctggagtacgggtccttcgagggcacgatccccgcgggcgagtacggcggcggcgag
gtcaccatctgggacgcgggcaccttcgatctggagaagtggcgcgatggcaaggaggtc
atcgccacgctgcacgggcggggcgacggcaccggcatcgacgggccgcgacggtacgcg
ctcatccacacgggcgggcacgggaaggccgacgcgaactggctgatccacctgatggag
cccgcggacgcgcccgccgcgcaccacccgaagcctgcgcgccccgcagcgctcgcgaag
gcgggcggccgcacgcgcgtcggcgcgcggcggaagggcggcgccgcatccgcccccgcg
cccatgctcgccaccgccgccaccggcgccggcctcgaccccgacgaggagtgggccgtc
gagatgaagtgggacggctaccgtgcgatcaccgtcgtcgcggacggccgggcgaccatc
acgagccgcaacggcgtcgacctcacggccgccttccccgagctcgccgagctgcccgac
cagctcgccgtcgacgccgcggtgctcgacggcgagatcgtggtgctgggcgacggcggc
cgccccgacttcggcctcctgcagacgcgcctcggcctcacgggcgagaaggagatcgcg
cgtgcccggaaggccgcgcccgtgcacctcatgctcttcgacgcgctcgcgatcggcgac
cgcgtgctcgttgacgagccgtaccgggagcgccgtgccgccctcctcgacgcggtccgg
gcgccgggccgcggccggatccaggtgccgcccgcgttcgacggcgacctcgacggagcg
ctcgccacgagccgcgagctcggcctcgagggcgtcgtcgccaagcgcgtcgacgcgccc
tacgagtcgggccgccggtcgagcgcctggctcaagatcaagcaccaccgcgcgcaggag
gtggtggtcggcggctggcgccccggacccggcagccggtcctccggcatcggctcgctg
ctcgtcggcgtccccggccccgacggcctcatgtacgcgggccgcgtcggcacgggcctc
accgagcgcgacctcgccgacgccctccgccgcttccgcccgctcgcgcggaagacgagc
cccttcgccgacgtgcccgccgccgacgcccgcgacgcgcactggatcaccccgcgtctc
gtcggcgaggtcgagttcgccgagtggacctccacgggccgcctccgccaggcgtcgtgg
cgcgggtggcggcacgacaagtcgcccgacgaggtcgtgcgcgaggactga

DBGET integrated database retrieval system